"Peptides LL-37 ([LL-37, 37 aa]), a scrambled LL-37, sLL-37 (RSLEGTDRFPFVRLKNSRKLEFKDIKGIKREQFVKIL) and IG-19 (IGKEFKRIVQRIKDFLRNL-NH2) were obtained from CPC Scientific (Sunnyvale, CA). The peptides were re-suspended in endotoxin-free water and stored at −20° until needed."

Abstract

Human cathelicidin LL-37 protects against infections and endotoxin-induced inflammation. In a recent study we have shown that IG-19, an LL-37-derived peptide, protects in a murine model of arthritis. Cytokine interleukin-32 (IL-32) is elevated and directly associated with the disease severity of inflammatory arthritis. Therefore, in this study we examined the effects of LL-37 and IG-19 on IL-32-induced responses in human peripheral blood-derived mononuclear cells (PBMC) and macrophages. We showed that CD14+ monocytes are the primary cells that produce pro-inflammatory tumour necrosis factor-α (TNF-α) following stimulation of PBMC with IL-32. We demonstrated that LL-37 and IG-19 significantly suppress IL-32-induced production of pro-inflammatory cytokines, e.g. TNF-α and IL-1β, without altering chemokine production. In contrast, LL-37 and IG-19 enhance the production of the anti-inflammatory cytokine IL-1RA. Further mechanistic studies revealed that LL-37 and IG-19 suppress IL-32-mediated phosphorylation of Fyn (Y420) Src kinase. In contrast, IL-32-mediated phosphorylation of AKT-1 (T308) and MKP-1 (S359) is not suppressed by the peptides. LL-37 and IG-19 alone induce the phosphorylation of MKP-1 (S359), which is a known negative regulator of inflammation. Furthermore, the peptides induce the activity of p44/42 mitogen-activated protein kinase, which is known to phosphorylate MKP-1 (S359). This is the first study to demonstrate the regulation of IL-32-induced inflammation by LL-37 and its derivative peptide IG-19. The mechanistic results from this study suggest that regulation of immune-mediated inflammation by these peptides may be controlled by the dual phosphatase MKP-1. We speculate that LL-37 and its derivatives may contribute to the control of immune-mediated inflammatory diseases.

SOCIAL MEDIA

Connect with us and stay updated by following our social media channels.

Latest Briefings from our Knowledge Center

Press Releases, Industry News, Articles, and Technical Content

  • Holt, Daniel P., Dhiraj Kumar, Sridhar Nimmagadda, and Robert F. Dannals. Journal of Labelled Compounds and Radiopharmaceuticals 66, no. 2 (2023): 47-54.

    to current Good Manufacturing Practice (cGMP) requirements. In addition, the production is … -NODA; Figure 1) was custom synthesized from CPC Scientific (San Jose, CA). The authentic …

  • Lyophilized NOTA-NT-20.3 (Ac-Lys(NOTA)-Pro-NMeArg-Arg-Pro-Tyr-Tle-Leu-OH

    Lin, Wilson, Eduardo Aluicio-Sarduy, Hailey A. Houson, Todd E. Barnhart, Volkan Tekin, Justin J. Jeffery, Ashley M. Weichmann, Kendall E. Barrett, Suzanne E. Lapi, and Jonathan W. Engle. Nuclear Medicine and Biology) 118 (2023): 108329.

    Lyophilized NOTA-NT-20.3 (Ac-Lys(NOTA)-Pro-NMeArg-Arg-Pro-Tyr-Tle-Leu, 1383.6 g/mol, “NT”, CPC Scientific) was diluted to 1 mg/mL in ultrapure water (Milli-Q, >18.2 MΩ-cm) and used without further purification.

  • Umberger, T.S., Ming, W., Cox, J.M., Konrad, R.J. and Siegel, R.W. Bioanalysis 14, no. 18 (2022): 1229-1239.

    • Lilly Research Laboratories, Eli Lilly & Company, Indianapolis, IN46285, USA

    Human K2 EDTA and P800 plasma (500 μl) was spiked with proglucagon 33–61, 35–61 and 36–61 stable-isotope-labeled internal standard peptides (CPC Scientific, custom order) and diluted with I buffer (25 mmol/l Tris-HCl, 25 mmol/l HEPES, 300 mmol/l NaCl, 0.1% (v/v) octyl β-D-glucopyranoside, pH 7.5).

  • Line, J.E.; Seal, B.S.; Garrish, J.K. Appl. Microbiol. 2022, 2, 688–700.

    Peptides were synthesized using standard solid-phase(Fmoc) chemistry with a peptide synthesizer (CPC Scientific Inc., Sunnyvale, CA 94089,USA, C12K-2β12 [..]

    September 23rd, 2022Antimicrobial Peptides, Citations
  • Kirk, N.S., Chen, Q., Wu, Y.G., Asante, A.L., Hu, H., Espinosa, J.F., Martínez-Olid, F., Margetts, M.B., Mohammed, F.A., Kiselyov, V.V. and Barrett, D.G. Nature Communications 13, no. 1 (2022): 5695.

    • Eli Lilly and Company, Lilly Corporate Center, Indianapolis, IN 46285, USA.

    Peptides were synthesized under contract by CPC Scientific, except for the N-terminally acetylated version of IM172N22 and the Glu3Arg, Glu3Ala, Glu4Arg, Glu4Ala, Glu5Ala, Glu5Arg, Trp6Ala, Gln8Ala, Ile9Ala, Glu10Ala, Glu10Arg and Tyr14Ala mutants of IM172N22

    September 12th, 2022Citations
  • Coskun, T., Urva, S., Roell, W.C., Qu, H., Loghin, C., Moyers, J.S., O’Farrell, L.S., Briere, D.A., Sloop, K.W., Thomas, M.K. and Pirro, V. Cell Metabolism 34, no. 9 (2022): 1234-1247.

    • Eli Lilly and Company, Lilly Corporate Center, Indianapolis, IN 46285, USA

    Homologous and heterologous competition experiments were performed with non-radioactive peptide analogues[127I]-Tyr1-GIP(1-42) and [127]-Tyr10-GIP(1-42) to ensure quantification of the high-affinity binding site of the GIPR. Peptide analogues were generated using synthetic [127I]-Tyr amino acid building blocks (CPC Scientific).

  • Cecil, D.L., Curtis, B., Gad, E., Gormley, M., Timms, A.E., Corulli, L., Bos, R., Damle, R.N., Sepulveda, M.A. and Disis, M.L. Scientific Reports 12, no. 1 (2022): 13618.

    1. Cancer Vaccine Institute, University of Washington, 850 Republican Street, Brotman Bld., 2nd Floor, Box 358050, Seattle, WA 98195-8050, USA.
    2. Janssen Research and Development LLC, Spring House, PA, USA.
    3. Janssen Vaccines and Prevention, Leiden, The Netherlands.

    The peptides were constructed and purified by high-performance liquid chromatography (> 90% pure; CPC Scientific).

    August 10th, 2022Citations
  • Zonari, A., Brace, L.E., Alencar-Silva, T., Porto, W.F., Foyt, D., Guiang, M., Cruz, E.A.O., Franco, O.L., Oliveira, C.R., Boroni, M. and Carvalho, J.L. Toxicology Reports 9 (2022): 1632-1638.

    Peptide 14 (ETAKHWLKGI) (Sup. Fig. 1) was purchased from CPC Scientific Inc. (USA), which synthesized the peptide by solid phase (Fmoc) on a Rink amide resin, with > 95% purity, in the form of acetate salt.

    August 5th, 2022Citations, Cosmetic Peptides
  • Rocklin API Manufacturing Facility

    CPC Scientific Inc., a leading global peptide CRDMO (Contract Research, Development, and Manufacturing Organization) has invested in a new peptide API (Active Pharmaceutical Ingredient) manufacturing site, bringing many new jobs to Rocklin, California. The 41,000 sq ft facility located at 3880 Atherton Rd, Rocklin, CA 95765 will be utilized to manufacture clinical to commercial grade peptide products for increased manufacturing capacity and will diversify CPC Scientific’s supply chain.

    CPC Scientific is entering an exciting period of growth and innovation for peptide and oligonucleotide therapeutic development and manufacturing, and we will continue to provide therapeutic APIs to pharmaceutical and biotech companies around the world. We are very pleased to partner with the City of Rocklin, California to bring manufacturing and Life-Science jobs to local American workers,” said Shawn Lee, PhD, CEO.

    June 22nd, 2022Press Releases

Contact Us