Skip to content
CPC Scientific LogoCPC Scientific Logo
  • Shop Catalog
    • Search
    • Browse Catalog
    • Browse by Category
    • Catalog MSDS
    • Terms and Conditions
  • Company
  • News
  • Careers
  • My Account
    • Register
  • Contact Us
  • Services
    GMP Peptide Manufacturing
    • Phase I, II, III & Commercial GMPHOT
    • Generic Peptide API DevelopmentHOT
    • Manufacturing Capacity
    • Cosmetic Peptides
    • Neoantigen Peptides
    Research Peptides
    • Custom Peptide Synthesis
    • FTE ServicesHOT
    • Cosmetic Peptides
    • Catalog PeptideORDER
    Oligonucleotide Services
    • GMP Oligonucleotide ManufacturingHOT
    • Oligonucleotide Services
    Peptide–Oligo Conjugate Services
    • Peptide Oligonucleotide Conjugates
    Specialties 
    • Project Management
    • Quality & Compliance
    GMP Peptide Manufacturing
    • Phase I, II, III & Commercial GMPHOT
    • Generic Peptide API DevelopmentHOT
    • Manufacturing Capacity
    • Cosmetic Peptides
    • Neoantigen Peptides
    Research Peptides
    • Custom Peptide Synthesis
    • FTE ServicesHOT
    • Cosmetic Peptides
    • Catalog PeptideORDER
    Oligonucleotide Services
    • GMP Oligonucleotide ManufacturingHOT
    • Oligonucleotide Services
    Peptide–Oligo Conjugate Services
    • Peptide Oligonucleotide Conjugates
    Specialties 
    • Project Management
    • Quality & Compliance
    • GMP Peptide ManufacturingHOT
      • Phase I, II, III & Commercial GMP Program OverviewHOT
      • Generic Peptide APIsHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptide Services
    • Research Peptides
      • Custom Services
        • Modifications
          • Peptide Macrocycles
          • Stapled Peptides
          • Dye Labeled Peptides
          • PEGylated Peptides
          • Click Peptides
          • Glycosylated Peptides
          • Phosphorylated Peptides
          • Peptoids
          • Unnatural Amino Acids
          • Peptide Libraries
          • Lipopeptides
          • Multiple Disulfide Bridges
          • Long Sequences
          • D-Amino Acids
          • Isotope Labeled Peptides
      • FTE ServicesHOT
      • Catalog PeptidesORDER
        • Search
        • Browse Catalog
        • Browse by Catagory
        • Catalog MSDS
        • Terms and Conditions
    • Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
    • Peptide Oligonucleotide Conjugates
      • Peptide Oligonucleotide Conjugates
    • Specialties
      • Project Management
      • Quality & Compliance
  • News & Events
    • Press Releases
    • Events
    • Videos
    • Webinars & Event Presentations
      • Webinar Series
      • Members Webinars
    • Symposium
      • Symposium Overview
      • Scientific Program
      • Speakers
      • Scheduled Events
      • Contact Symposium
  • Knowledge Center
    • White Papers
    • Brochures & Flyers
    • Publications & Citations
      • Search Product Citations
      • Peer-Reviewed Publications
      • GMP Manufacturing Citations
      • Industrial CollaborationsNEW
      • GLP-1 NCE DevelopmentNEW
      • Posters
    • Articles & Insights
    • Webinars & Event Presentations
      • Webinar Series
      • Members Webinars
    • Frequently Asked Questions
    • Glossary
    • MembersPORTAL
    • Browse Knowledge Center
  • About
    • Company Profile
    • Leadership
    • Group History
    • LocationsNEW
    • Careers
  • Quote
    • Quotation Request
    • Frequently Asked Questions
    • Contact Us
  • Cart0
    CPC Scientific LogoCPC Scientific Logo
    • Services
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      • GMP Peptide ManufacturingHOT
        • Phase I, II, III & Commercial GMP Program OverviewHOT
        • Generic Peptide APIsHOT
        • Manufacturing Capacity
        • Cosmetic Peptides
        • Neoantigen Peptide Services
      • Research Peptides
        • Custom Services
          • Modifications
            • Peptide Macrocycles
            • Stapled Peptides
            • Dye Labeled Peptides
            • PEGylated Peptides
            • Click Peptides
            • Glycosylated Peptides
            • Phosphorylated Peptides
            • Peptoids
            • Unnatural Amino Acids
            • Peptide Libraries
            • Lipopeptides
            • Multiple Disulfide Bridges
            • Long Sequences
            • D-Amino Acids
            • Isotope Labeled Peptides
        • FTE ServicesHOT
        • Catalog PeptidesORDER
          • Search
          • Browse Catalog
          • Browse by Catagory
          • Catalog MSDS
          • Terms and Conditions
      • Oligonucleotide Services
        • GMP Oligonucleotide ManufacturingHOT
        • Oligonucleotide Services
      • Peptide Oligonucleotide Conjugates
        • Peptide Oligonucleotide Conjugates
      • Specialties
        • Project Management
        • Quality & Compliance
    • News & Events
      • Press Releases
      • Events
      • Videos
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Symposium
        • Symposium Overview
        • Scientific Program
        • Speakers
        • Scheduled Events
        • Contact Symposium
    • Knowledge Center
      • White Papers
      • Brochures & Flyers
      • Publications & Citations
        • Search Product Citations
        • Peer-Reviewed Publications
        • GMP Manufacturing Citations
        • Industrial CollaborationsNEW
        • GLP-1 NCE DevelopmentNEW
        • Posters
      • Articles & Insights
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Frequently Asked Questions
      • Glossary
      • MembersPORTAL
      • Browse Knowledge Center
    • About
      • Company Profile
      • Leadership
      • Group History
      • LocationsNEW
      • Careers
    • Quote
      • Quotation Request
      • Frequently Asked Questions
      • Contact Us
    • Cart0
      1. Home
      2. Posts
      3. Antimicrobial Peptides

      Antimicrobial Peptides Archive

      • Antimicrobial Peptide Brochure Request

        Antimicrobial Peptides (AMPs) are found in virtually every living organism—bacteria, fungi, plants, invertebrates, and vertebrates—and play a critical role in the innate and acquired immune responses to pathogenic attacks. AMPs are released by various cells and organelles, such as immune cells (granulocytes and macrophages), epithelial cells (vaginal epithelium, respiratory epithelium, and oral cavity epithelium), and the small intestine.

        Published On: February 5th, 2024Categories: Antimicrobial Peptides, Brochure Request, Brochures
        Learn More
      • Selected Antimicrobial Peptides Inhibit In Vitro Growth of Campylobacter spp.

        Line, J.E.; Seal, B.S.; Garrish, J.K. Appl. Microbiol. 2022, 2, 688–700.

        Peptides were synthesized using standard solid-phase(Fmoc) chemistry with a peptide synthesizer (CPC Scientific Inc., Sunnyvale, CA 94089,USA, C12K-2β12 [..]

        Published On: September 23rd, 2022Categories: Antimicrobial Peptides, Citations
        Learn More
      • Murine Model of Sinusitis Infection for Screening Antimicrobial and Immunomodulatory Therapies.

        Alford, M. A.; Choi, K.-Y. G.; Trimble, M. J.; Masoudi, H.; Kalsi, P.; Pletzer, D.; Hancock, R. E., Frontiers in Cellular and Infection Microbiology 2021, 2021, 11, 75.

        "Peptides IDR-1018 (VRLIVAVRIWRR-NH2) (Achtman et al., 2012), DJK-5 (all D-amino acids vqwrairvrvir-NH2) (de la Fuente-Nunez et al., 2015) and IDR-1002 (VQRWLIVWRIRK-NH2) (Nijnik et al., 2010), were synthesized by CPC Scientific [..]"

        Published On: March 12th, 2021Categories: Antimicrobial Peptides, Citations, D-Amino Acids
        Learn More
      • Recovery of Oral In Vitro Biofilms after Exposure to Peptides and Chlorhexidine.

        Zhang, T.; Xia, L.; Wang, Z.; Hancock, R. E.; Haapasalo, M., Journal of Endodontics 2021, 47 (3), 466-471.

        "Peptides DJK-5 and 1018 were synthesized using solid-phase 9-fluorenylmethoxy carbonyl chemistry and purified to a purity of >95% using reverse-phase high-performance liquid chromatography by CPC Scientific (Sunnyvale, CA) as previously described [..]"

        Published On: March 1st, 2021Categories: Antimicrobial Peptides, D-Amino Acids
        Learn More
      • Synthetic host defense peptide IDR-1002 reduces inflammation in Pseudomonas aeruginosa lung infection.

        Wuerth, Kelli C., Reza Falsafi, and Robert EW Hancock. PloS One 12, no. 11 (2017): e0187565.

        "LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2) was purchased from CPC Scientific (Sunnyvale, California, USA).."

        Published On: November 6th, 2017Categories: Antimicrobial Peptides, Citations
        Learn More
      • Cathelicidins Inhibit Escherichia coli–Induced TLR2 and TLR4 Activation in a Viability-Dependent Manner.

        Coorens, Maarten, et al. The Journal of Immunology 199.4 (2017): 1418-1428.

        "CATH-2 and LL-37 were synthesized by Fmoc-chemistry at CPC Scientific (Sunnyvale, CA)."

        Published On: August 15th, 2017Categories: Antimicrobial Peptides, Citations
        Learn More
      • Alpha-defensin-dependent enhancement of enteric viral infection.

        Wilson, Sarah S., et al. PLoS Pathogens 13.6 (2017): e1006446.

        "Cryptdin 2 (UniProtKB: P28309, LRDLVCYCRTRGCKRRERMNGTCRKGHLMYTLCCR)... obtained by oxidative refolding of partially purified linear peptides (synthesized by CPC Scientific...) and purifying the correctly folded species by reverse-phase high-pressure liquid chromatography (RP-HPLC). Purity was determined by analytical RP-HPLC, and the mass of the disulfide-bonded peptides was verified by high mass accuracy liquid chromatography-mass spectrometry."

        Published On: June 16th, 2017Categories: Antimicrobial Peptides, Citations, Multiple Disulfide Bridges
        Learn More
      • Molecular and serologic markers of HPV 16 infection are associated with local recurrence in patients with oral cavity squamous cell carcinoma.

        Huang, Chung-Guei, et al. Oncotarget 8.21 (2017): 34820-34835

        "Synthetic peptides of HPV 16 L1 (N′-C-KHTPPAPKEDPLKK-C′; position: 456−471)/E6 (N′-C-RTAMFQDPQERPRK-C′; position: 5−18) and a recombination protein of full-length HPV 16 E7-histag fusion protein (N′-MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEED-EIDGPAGQAEPDRAHYNIVTFCCKCDSTLRL-CVQSTHVDIRTLEDLLMGTLGIVCPICSQKP-C′; position: 1−98) were manufactured by CPC Scientific Inc."

        Published On: March 31st, 2017Categories: Antimicrobial Peptides, Long Sequences, Multiple Disulfide Bridges
        Learn More
      • Topical nanomedicine for the combination delivery of immuno-modulatory peptides for accelerated chronic wound healing and anti-bacterial activity.

        Fumakia, M. MS Thesis, University of Manitoba 2016.

        LL37 (host defense peptide) (Table 2) was a purchased from (custom synthesized by CPC Scientific Inc., CA, USA)

        Published On: July 22nd, 2016Categories: Antimicrobial Peptides, Citations, Cosmetic Peptides
        Learn More
      • A small intestinal organoid model of non-invasive enteric pathogen–epithelial cell interactions.

        Wilson, Sarah S., et al. Mucosal Immunology 8.2 (2015): 352-361.

        "Folded Crp23 was created from a synthesized 80% pure linear peptide (CPC Scientific, Sunnyvale, CA) by the same procedure as previously reported for the α-defensin HD5"

        Published On: August 13th, 2014Categories: Antimicrobial Peptides, Citations, Multiple Disulfide Bridges
        Learn More
      12Next
      CPC Scientific Inc.

      Our Services

      • GMP Peptide Manufacturing
      • GMP Oligonucleotide Manufacturing
      • Custom Peptide Synthesis
      • Oligonucleotide Services
      • Peptide Oligonucleotide Conjugates
      • Generic Peptides
      • FTE Services

      Company

      • About Us
      • Group History
      • Press Releases
      • Scheduled Events
      • Careers

      Legal

      • Terms and Conditions
      • Privacy Policy

      Catalog Peptide Orders

      • Shop
      • Orders
      • Shipping Conditions
      • Order FAQs

      Support

      • Knowledge Center
      • Frequently Asked Questions
      • Contact Us

      Follow Us!

      Quotation
      CPC Scientific Inc. is a CRDMO specializing in peptide and oligonucleotide production and therapeutic development.
      We are your TIDES Partner from Concept to Commercial.

      Copyright ©2025 CPC Scientific Inc. | 3880 Atherton Rd, Rocklin, CA 95765, USA | +1 408-734-3800 | All Rights Reserved
      Page load link
      The CPC Scientific website uses cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our Privacy Policy.
      Accept Reject
      Go to Top