McGonigle, Sharon, Utpal Majumder, Donna Kolber-Simonds, Jiayi Wu, Andrew Hart, Thomas Noland, Karen TenDyke et al. Cell Communication and Signaling 17, no. 1 (2019): 67.
Native Cltx (Cltx-CONH2) was synthesized at CPC Scientific (Sunnyvale, CA) by routine methods and stored dry at -20 °C.
Lee, Chul-Jin, Mitra S. Rana, Chanhyung Bae, Yan Li, and Anirban Banerjee. Journal of Biological Chemistry 294, no. 1 (2019): 231-245.
Substrate-mimicking peptides for wild-type or mutant Wnts with a point-mutation, varying in lengths or the number of disulfide bonds were purchased from CPC Scientific (Sunnyvale, CA)..
Wilson, Sarah S., et al. PLoS Pathogens 13.6 (2017): e1006446.
"Cryptdin 2 (UniProtKB: P28309, LRDLVCYCRTRGCKRRERMNGTCRKGHLMYTLCCR)... obtained by oxidative refolding of partially purified linear peptides (synthesized by CPC Scientific...) and purifying the correctly folded species by reverse-phase high-pressure liquid chromatography (RP-HPLC). Purity was determined by analytical RP-HPLC, and the mass of the disulfide-bonded peptides was verified by high mass accuracy liquid chromatography-mass spectrometry."
Huang, Chung-Guei, et al. Oncotarget 8.21 (2017): 34820-34835
"Synthetic peptides of HPV 16 L1 (N′-C-KHTPPAPKEDPLKK-C′; position: 456−471)/E6 (N′-C-RTAMFQDPQERPRK-C′; position: 5−18) and a recombination protein of full-length HPV 16 E7-histag fusion protein (N′-MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEED-EIDGPAGQAEPDRAHYNIVTFCCKCDSTLRL-CVQSTHVDIRTLEDLLMGTLGIVCPICSQKP-C′; position: 1−98) were manufactured by CPC Scientific Inc."
Wiens, Mayim E., and Jason G. Smith. "Alpha-defensin HD5 inhibits furin cleavage of human papillomavirus 16 L2 to block infection." Journal of Virology 89, no. 5 (2015): 2866-2874.
"Folded HD5 was made from a synthesized 80% pure linearized peptide (CPC Scientific, Sunnyvale, CA) and purified by reverse-phase high-pressure liquid chromatography, and an HD5 derivative containing L-α-aminobutyric acid in place of cysteine (HD5 Abu) was chemically synthesized, as previously described.."
Wilson, Sarah S., et al. Mucosal Immunology 8.2 (2015): 352-361.
"Folded Crp23 was created from a synthesized 80% pure linear peptide (CPC Scientific, Sunnyvale, CA) by the same procedure as previously reported for the α-defensin HD5"
Gounder, Anshu P., et al. Journal of Biological Chemistry 287.29 (2012): 24554-24562.
"..folded HD5 was generated from a synthesized 80% pure linear peptide (CPC Scientific, Sunnyvale, CA) by thiol disulfide reshuffling overnight at room temperature in the presence of 3 mM reduced and 0.3 mM oxidized glutathione, 2 M guanidine hydrochloride, and 0.25 M sodium bicarbonate, pH 8.3, at a peptide concentration of 0.25 mg/ml [..] All α-defensins were quantified by UV absorbance at 280 nm using calculated molar extinction coefficients (18)."
Llenado, R. Alan, et al. Infection and Immunity 77.11 (2009): 5035-5043.
"(R/K)-RMAD-4 [rhesus myeloid α-defensin 4] [(R1/2/5/7/10/13/14/26/33K)-RMAD-462-94] was custom synthesized by CPC Scientific, Inc. (San Jose, CA) and refolded as described previously…"
