Custom and catalog peptide product citations (including co-authored publications)
Peer-reviewed co-authored publications
Citations of peptide products manufactured under GMP conditions
Citations and publications with pharmaceutical companies
Benefit from decades of experience in GLP-1-Based Drug Development
Scientific posters prepared for conferences
Selected Custom Peptide Citations
- All
- Antimicrobial Peptides
- Click Peptides
- Cosmetic Peptides
- Dye-Labeled
- FRET Substrates
- GMP Peptide Manufacturing
- Green Chemistry
- Isotope-Labeled Peptides
- Lipidation
- Long Sequences
- Metal Chelates
- Multiple Disulfide Bridges
- Other Research
- PEGylation
- Peptide Glycosylation
- Peptide Libraries
- Peptide Macrocycles
- Peptoids
- Phosphorylated Peptides
- Stapled Peptides
- Unnatural Amino Acids
Chen, D., Mirski, M. A., Chen, S., Bryden, W. A., McLoughlin, M., Kiser, K. M., Caton, E. R., Haddaway, C. R., Cetta, M. S., & Pan, Y. PNAS nexus (2024), 3(9).
PEG36-Nle(O-Bzl)-Met(O)2-Oic-Abu-ACC was designed in house and synthesized by CPC Scientific Inc (San Jose, CA, Fig. S1). Amino-PEG36-acid (CAS: 196936-04-6) and 2-(7-amino-2-oxochromen-4-yl)acetamide (CAS:296236-23-2) were used for the synthesis. The synthesized sensor was resuspended in high-performance liquid chromatography (HPLC)-grade water with a concentration of 200 µM.
Chayanon Ngambenjawong, Henry Ko, Tahoura Samad, Novalia Pishesha, Hidde L. Ploegh, and Sangeeta N. Bhatia. ACS Nano 2025 19 (10), 9958-9970.
Therapeutic peptides and their Cy7-labeled analogs (Table S1 and Figure S14) were synthesized by CPC Scientific (CA, U.S.A.) via standard Fmoc-based SPPS.
Dakin, L.A., Xing, L., Hall, J. et al. Nat Commun 16, 4579 (2025).
The enzymatic reaction was started with the addition of 8 µM of substrate Atto655 - (Ser-Arg-Gly-Ala)3 (CPC Scientific Inc.) in assay buffer.
Olivia R. Buonarati, Nidia Quillinan, K. Ulrich Bayer. bioRxiv 2025.
tatCN19o. CPC Scientific; Coultrap et al. 2011. N/A (custom peptide).
J. Zeng, G.W.Z. Loi, E.N. Saipuljumri, M.A. Romero Durán, O. Silva-García, J.M. Perez-Aguilar, V.M. Baizabal-Aguirre, & C.H. Lo. Proc. Natl. Acad. Sci. U.S.A. 2024 121 (14).
FKC (FKCRRWQWRMKK-NH2), rhodamine-conjugated FKC (Rho-FKCRRWQWRMKK-NH2), and IDR (VQRWLIVWRIRK-NH2) peptides were synthesized using solid phase F-moc chemistry by CPC Scientific, Inc. with a purity greater than 95%.
Nakagawa, Mayumi, Teresa Evans, Milan Bimali, Hannah Coleman, Jasmine Crane, Nadia Darwish, Jennifer L. Faulkner et al. MedRxiv (2025): 2025-01.
The vaccine consisted of four current good manufacturing production-grade synthetic peptides covering the HPV 16 E6 protein [amino acid (aa)1-45, 46-80, 81-115, and 116-158] (CPC Scientific, San Jose, CA [..]
Singh, S.S., Calvo, R., Kumari, A., Sable, R.V., Fang, Y., Tao, D., Hu, X., Castle, S.G., Nahar, S., Li, D. and Major, E. Molecular Cancer Therapeutics (2024).
- CPC Scientific Inc., 160E Tasman Dr., Suite 200, San Jose, CA 95134
[..] assembling the peptide on the Rink Amide resin and attaching the PEG azide moiety to the N-terminal Lys, the Dde group was removed as previously shown and coupled to the Fmoc-PEG2-acid. Removal of the Fmoc followed by simultaneously click/coupling to bicyclo[6.1.0]non-4-yn-9-ylmethyl (2,5-dioxopyrrolidin-1-yl) carbonate gave 1c which was deprotected and cleaved from the resin to give 1c.
Alvarez, N., Adam, G.C., Howe, J.A., Sharma, V., Zimmerman, M.D., Dolgov, E., Rasheed, R., Nizar, F., Sahay, K., Nelson, A.M. and Park, S. Viruses 16, no. 7 (2024): 1158.
- Center for Discovery and Innovation, Hackensack Meridian Health, 111 Ideation Way, Nutley, NJ 07110, USA
- Merck & Co., Inc., Rahway, NJ 07065, USA
The enzymatic activity of recombinantly expressed 3CLPro enzymes from different coronaviruses was measured using the following synthetic quenched FRET peptide: CP488-ESATLQSGLRKAK- (CPQ2)-NH2 (CPC Scientific, San Jose, CA, USA).
Liu, J., Heddleston, J., Perkins, D.R., Chen, J.J.H., Ghanbarpour, A., Smith, B.W., Miles, R., Aihara, E. and Afshar, S. Scientific Reports 14, no. 1 (2024): 13437.
- Protein Engineering, Lilly Biotechnology Center, Eli Lilly and Company, San Diego, CA, 92121, USA
- Biotechnology Research, Lilly Corporate Center, Eli Lilly and Company, Indianapolis, IN, 46221, USA
- Genetic Medicine, Lilly Corporate Center, Eli Lilly and Company, Indianapolis, IN, 46221, USA
Synthetic peptides were ordered from CPC scientific with > 95% purity. NNJA peptides in the formats of monomer or dendrimer were conjugated by click chemistry to siRNA targeting hypoxanthine–guanine phosphoribosyltransferase (HPRT) gene [..]
Alencar-Silva, Thuany, Stefhani Martins de Barcelos, Amandda Silva-Carvalho, Mauricio Gonçalves da Costa Sousa, Taia Maria Berto Rezende, Robert Pogue, Felipe Saldanha-Araújo et al. Cells 13, no. 10 (2024): 813.
Pep 14 (ETAKHWLKGI) was synthesized by CPC Scientific (Sunnyvale, CA, USA) and reconstituted in ultrapure water. The peptide was aliquoted and stored at −20 °C until use.
Hao, Liangliang, Natalie Boehnke, Susanna K. Elledge, Nour-Saïda Harzallah, Renee T. Zhao, Eva Cai, Yu-Xiong Feng et al. Proceedings of the National Academy of Sciences 121, no. 11 (2024): e2307802121.
The azido-modified biosensor peptide (sequence B(biotin)-eGvndneeGffsarK-(FAM)dGGPLGVRGKK-(N3)) was synthesized by CPC Scientific with >90% purity.
Yarovaya, Olga I., Aleksandr S. Filimonov, Dmitriy S. Baev, Sophia S. Borisevich, Anna V. Zaykovskaya, Varvara Yu Chirkova, Mariya K. Marenina et al. " Viruses 16, no. 2 (2024): 215.
Fluorescence was observed by an assay involving a synthetic fluorescently labeled peptide substrate of the type DabcylKTSAVLQ↓SGFRKME(Edans)NH2 (more than 95% purity, CPC Scientific Inc., Hangzhou, China) containing the site digested by the main protease of coronavirus. The fluorescent dye attached to the peptide substrate allows the FRET effect to be implemented [..]
Shurtleff, V.W., Layton, M.E., Parish, C.A., Perkins, J.J., Schreier, J.D., Wang, Y., Adam, G.C., Alvarez, N., Bahmanjah, S., Bahnck-Teets, C.M. and Boyce, C.W. Journal of Medicinal Chemistry 67, no. 5 (2024): 3935-3958.
- Center for Discovery and Innovation, Hackensack Meridian Health. 111 Ideation Way. Nutley, New Jersey 07110, United States.
- Merck & Co., Inc., Rahway, New Jersey 07065, United States.
The enzymatic activity of recombinantly expressed 3CLPro enzymes from different coronaviruses was measured using the following synthetic quenched FRET peptide: CP488-ESATLQSGLRKAK- (CPQ2)-NH2 (CPC Scientific, San Jose, CA.
Quigley, Neil Gerard, Katja Steiger, Stefanie Felicitas Färber, Frauke Richter, Wilko Weichert, and Johannes Notni. Molecular Pharmaceutics (2024), 21(4), 1827-1837.
… by positron emission tomography (PET) imaging and ex vivo … clinical PD-L1 PET imaging because it detects even very low … The peptide WL12 was purchased from CPC Scientific (San …
Goh, Joleen Pei Zhen. Nanyang Technological University (2023)
9 generic fluorogenic substrates (CPC Scientific) (Figure S4) were added to the final concentration of 20 μM. Fluorescence was measured at Excitation/Emission=330/390 nm on BioTek Synergy H1 microplate reader and proteolytic activity was calculated as a change in relative fluorescence units per sec using the slope of the linear range for this signal.
Design-rules for stapled peptides with in vivo activity and their application to Mdm2/X antagonists.
Chandramohan, A., Josien, H., Yuen, T.Y., Duggal, R., Spiegelberg, D., Yan, L., Juang, Y.C.A., Ge, L., Aronica, P.G., Kaan, H.Y.K. and Lim, Y.H. Nature Communications 15, no. 1 (2024): 489.
- Merck & Co., Inc., Kenilworth, NJ 07033, USA.
- Merck & Co., Inc., Boston, MA 02115, USA
- Merck & Co., Inc., West Point, PA 19486, USA
- Genentech, South San Francisco, CA 94080, USA
We thank Evans (Chen) Ge, Mike (Dixin) Xue, and Simon (Junhua) Li at Chinese Peptide Company (CPC) for peptide synthesis support.
Kikuchi, F., Ikeda, Z., Kakegawa, K., Nishikawa, Y., Sasaki, S., Fukuda, K., Takami, K., Banno, Y., Nishikawa, H., Taya, N. and Nakahata, T. Bioorganic & Medicinal Chemistry 93 (2023): 117462.
- Research, Takeda Pharmaceutical Company Limited, 26-1, Muraoka-Higashi 2-chome, Fujisawa, Kanagawa 251-8555, Japan
- Pharmaceutical Sciences, Takeda Pharmaceutical Company Ltd., 26-1, Muraoka-Higashi 2-chome, Fujisawa, Kanagawa 251-8555, Japan
5FAM-Abu-Gly-Asp-Asp-Asp-Lys-Ile-Val-Gly-Gly-Lys(CPQ2)-Lys-Lys-NH2 (purity: 97.2%, CPC Scientific, Inc.) was diluted with an assay buffer to prepare a 5.4 μM substrate solution.
Senotherapeutic peptide treatment reduces biological age and senescence burden in human skin models.
Zonari, A.; Brace, L. E.; Al-Katib, K.; Porto, W. F.; Foyt, D.; Guiang, M.; Cruz, E. A. O.; Marshall, B.; Gentz, M.; Guimaraes, G. R.; Franco, O. L.; Oliveira, C. R.; Boroni, M.; Carvalho, J. L., NPJ Aging 2023, 9 (1), 10.
The top hit peptides selected (Pep 14, 144, 156, 195, and 393) from the screening and the fluorescence labeled peptide (5FAM-PEG2-Pep 14) were purchased from CPC Scientific Inc. (USA), which synthesized the peptide by solid phase (Fmoc) on a Rink amide resin, with >95% purity, in the form of acetate salt.
Järveläinen, Harri A., Christian Schmithals, Maike von Harten, Bianca Kakoschky, Thomas J. Vogl, Stephen Harris, Claire Henson, Gemma Bullen-Clerkson, and Albrecht Piiper. International Journal of Molecular Sciences 24, no. 6 (2023): 5700.
The cyclic iRGD/CEND-1 peptide [sequence: CRGDKGPDC] and RGD control peptide (CRGDDGPKC) for pre-clinical use was sourced either from GenScript (Piscataway, NJ, USA) or CPC Scientific (Hangzhou, China).
Lin, Wilson, Eduardo Aluicio-Sarduy, Hailey A. Houson, Todd E. Barnhart, Volkan Tekin, Justin J. Jeffery, Ashley M. Weichmann, Kendall E. Barrett, Suzanne E. Lapi, and Jonathan W. Engle. Nuclear Medicine and Biology) 118 (2023): 108329.
Lyophilized NOTA-NT-20.3 (Ac-Lys(NOTA)-Pro-NMeArg-Arg-Pro-Tyr-Tle-Leu, 1383.6 g/mol, “NT”, CPC Scientific) was diluted to 1 mg/mL in ultrapure water (Milli-Q, >18.2 MΩ-cm) and used without further purification.
Development of a selective, sensitive and robust oxyntomodulin dual monoclonal antibody immunoassay.
Umberger, T.S., Ming, W., Cox, J.M., Konrad, R.J. and Siegel, R.W. Bioanalysis 14, no. 18 (2022): 1229-1239.
- Lilly Research Laboratories, Eli Lilly & Company, Indianapolis, IN46285, USA
Human K2 EDTA and P800 plasma (500 μl) was spiked with proglucagon 33–61, 35–61 and 36–61 stable-isotope-labeled internal standard peptides (CPC Scientific, custom order) and diluted with I buffer (25 mmol/l Tris-HCl, 25 mmol/l HEPES, 300 mmol/l NaCl, 0.1% (v/v) octyl β-D-glucopyranoside, pH 7.5).
Line, J.E.; Seal, B.S.; Garrish, J.K. Appl. Microbiol. 2022, 2, 688–700.
Peptides were synthesized using standard solid-phase(Fmoc) chemistry with a peptide synthesizer (CPC Scientific Inc., Sunnyvale, CA 94089,USA, C12K-2β12 [..]
Coskun, T., Urva, S., Roell, W.C., Qu, H., Loghin, C., Moyers, J.S., O’Farrell, L.S., Briere, D.A., Sloop, K.W., Thomas, M.K. and Pirro, V. Cell Metabolism 34, no. 9 (2022): 1234-1247.
- Eli Lilly and Company, Lilly Corporate Center, Indianapolis, IN 46285, USA
Homologous and heterologous competition experiments were performed with non-radioactive peptide analogues[127I]-Tyr1-GIP(1-42) and [127]-Tyr10-GIP(1-42) to ensure quantification of the high-affinity binding site of the GIPR. Peptide analogues were generated using synthetic [127I]-Tyr amino acid building blocks (CPC Scientific).
Zonari, A., Brace, L.E., Alencar-Silva, T., Porto, W.F., Foyt, D., Guiang, M., Cruz, E.A.O., Franco, O.L., Oliveira, C.R., Boroni, M. and Carvalho, J.L. Toxicology Reports 9 (2022): 1632-1638.
Peptide 14 (ETAKHWLKGI) (Sup. Fig. 1) was purchased from CPC Scientific Inc. (USA), which synthesized the peptide by solid phase (Fmoc) on a Rink amide resin, with > 95% purity, in the form of acetate salt.
Ikeda, Z., Kakegawa, K., Kikuchi, F., Itono, S., Oki, H., Yashiro, H., Hiyoshi, H., Tsuchimori, K., Hamagami, K., Watanabe, M. and Sasaki, M. Journal of Medicinal Chemistry 65, no. 12 (2022): 8456-8477.
- Research, Takeda Pharmaceutical Company Limited, 26-1, Muraokahigashi 2-chome, Fujisawa, Kanagawa 251-8555, Japan
Subsequently, 5FAM–Abu–Gly–Asp–Asp–Asp–Lys–Ile–Val–Gly–Gly–Lys(CPQ2)–Lys–Lys–NH2 (purity: 97.2%, CPC Scientific, Inc.) was diluted with an assay buffer to prepare a 2.1 μM substrate solution.
Bekdemir, Ahmet, Eden EL Tanner, Jesse Kirkpatrick, Ava P. Soleimany, Samir Mitragotri, and Sangeeta N. Bhatia Advanced Healthcare Materials (2022): 2102685.
Peptides [TDN-qFAM, C-(PEG)2-K(CPQ2)-GGGSRPfGG-5FAM] were obtained from Tufts University Peptide Core Facility or CPC Scientific, Inc (USA)
Mac, Quoc D., Anirudh Sivakumar, Hathaichanok Phuengkham, Congmin Xu, James R. Bowen, Fang-Yi Su, Samuel Z. Stentz et al. Nature Biomedical Engineering (2022): 1-15.
"FITC-labelled GzmB substrate peptides with internal quencher ((5FAM)aIEFDSG(K-CPQ2)kkc) were synthesized by CPC Scientific and used for all in vitro activity assays. [..] Quenched fluorescent peptides for screening candidate substrates ((5FAM)-{substrate}-(K-DABCYL)-amide"
Lopez, Andrea, Denis E. Reyna, Nadege Gitego, Felix Kopp, Hua Zhou, Miguel A. Miranda-Roman, Lars Ulrik Nordstrøm et al. Nature Communications 13, no. 1 (2022): 1-18.
"Hydrocarbon-stapled peptide corresponding to the BH3 domain of BIM, FITC-BIM SAHBA2: FITC-βAla-EIWIAQELRS5IGDS5F’NAYYA-CONH2, where S5 represents the non-natural amino acid inserted for olefin metathesis, was synthesized, purified at >95% purity by CPC Scientific Inc."
Lenz, Morgan R., Shih-Yen Tsai, Anne E. Roessler, Yang Wang, Periannan Sethupathi, W. Keith Jones, Gwendolyn L. Kartje, and William H. Simmons. Journal of Pharmacology and Experimental Therapeutics 380, no. 3 (2022): 220-229.
"The ST-115 [ [(S)-2-mercapto-4-methylpentanoyl]-4(S)-fluoro-Pro-Pro-3(R)-beta-Pro] preparation used in this study was custom synthesized by CPC Scientific, Inc., (Sunnyvale, CA), a GMP-capable company. The synthetic scheme is detailed in US patent"
Cesaro, Angela, Marcelo DT Torres, Rosa Gaglione, Eliana Dell’Olmo, Rocco Di Girolamo, Andrea Bosso, Elio Pizzo et al. ACS Nano 16, no. 2 (2022): 1880-1895.
Expression and isolation of recombinant peptides were carried out as previously described.20 CATH-2 and (ri)-r(P)ApoBSPro peptides were obtained from CPC Scientific Inc. (Sunnyvale, CA) and CASLO ApS (Kongens Lyngby, Denmark), respectively.
Soleimany, Ava P., [..] Sangeeta N. Bhatia. Cancer Research 81, no. 1 (2021): 213-224.
All peptides were synthesized by CPC Scientific (Sunnyvale, CA) and reconstituted in dimethylformamide (DMF) unless otherwise specified. Sequences are provided in Supplementary Table S1.
Cazanave, S.C., Warren, A.D., Pacula, M., Touti, F., Zagorska, A., Gural, N., Huang, E.K., Sherman, S., Cheema, M., Ibarra, S. and Bates, J. Science Translational Medicine 13, no. 616 (2021): eabe8939.
All peptides were synthesized by CPC Scientific Inc. For fluorogenic assays, peptides were flanked with the fluorophore-quencher pair 5-FAM-CPQ2. For in vivo urine experiments, peptides were barcoded with Glu-Fib–derived and heavy isotope–labeled peptides. PEGylated peptides were pooled prepared before in vivo experiments and stored at 4°C in phosphate-buffered saline.
Diao, J., Komura, R., Sano, T., Pantua, H., Storek, K.M., Inaba, H., Ogawa, H., Noland, C.L., Peng, Y., Gloor, S.L. and Yan, D. Journal of Bacteriology 203, no. 13 (2021): 10-1128.
- Departments of Infectious Diseases, Structural Biology, Biochemical and Cellular Pharmacology, Translational Immunology, Pathology, Protein Chemistry, Early Discovery Biochemistry, Genentech, South San Francisco, California, USA
For the Lgt biochemical assay, the Pal-IAAC and Pal-IAAA peptides were synthesized by CPC Scientific.
Axiak-Bechtel, Sandra M., Stacey B. Leach, David G. Scholten, Jessica R. Newton-Northup, Brendan J. Johnson, H. E. Durham, Kenneth A. Gruber, and Michael F. Callahan. Pharmacology Research & Perspectives 9, no. 3 (2021): e00777.
TCMCB07 [a cyclic substituted melanocortin antagonist with the structure Ac- Nle- cyclo[Asp- Pro- DNal(2’)-Arg- Trp- Lys]- DVal- DPro- NH2] was manufactured by CPC Scientific Inc. under cGMP conditions. Active pharmaceutical ingredient was dissolved in milliQ water at 10 mg ml−1, sterile filtered [..]”
Ramasubramanian, Anusuya, Riya Muckom, Caroline Sugnaux, Christina Fuentes, Barbara L. Ekerdt, Douglas S. Clark, Kevin E. Healy, and David V. Schaffer. ACS Biomaterials Science & Engineering 7, no. 4 (2021): 1344-1360.
A cyclic 11-MUA adhesion peptide (CPC Scientific Inc., Sunnyvale, CA) was also synthesized via standard Fmoc chemistry and cyclized via a lactam bond between Asp(1) and Lys(9) to form (11-MUA)-GG-PEG 2 -cyclo(DMGDGRPRK)-NH 2 or 11-MUA-cyclic (7C-1).
Libiger, O., Shaw, L.M., Watson, M.H., Nairn, A.C., Umaña, K.L., Biarnes, M.C., Canet‐Avilés, R.M., Jack Jr, C.R., Breton, Y.A., Cortes, L. and Chelsky, D. Alzheimer's & Dementia 17, no. 12 (2021): 1976-1987.
- Janssen Research and Development, 3210 Merryfield Row, San Diego, CA 92121, USA.
- Foundation for the National Institutes of Health, North Bethesda, Maryland, USA
- Department of Radiology, Mayo Clinic, Rochester, Minnesota, USA
- Merck & Co., Inc., West Point, Pennsylvania, USA
Purified synthetic stable isotope (15N and 13C) labeled (SIL) peptides were from CPC Scientific (EDSLEAGLPLQVR [CMGA]; SLGVGFATR [FABPH]; VLEYLNQEK [SCG2]; and THLGEALAPLSK [VGF]); and JPT Peptide Technologies (TNYLYGK [NPTX2]).
Alford, M. A.; Choi, K.-Y. G.; Trimble, M. J.; Masoudi, H.; Kalsi, P.; Pletzer, D.; Hancock, R. E., Frontiers in Cellular and Infection Microbiology 2021, 2021, 11, 75.
"Peptides IDR-1018 (VRLIVAVRIWRR-NH2) (Achtman et al., 2012), DJK-5 (all D-amino acids vqwrairvrvir-NH2) (de la Fuente-Nunez et al., 2015) and IDR-1002 (VQRWLIVWRIRK-NH2) (Nijnik et al., 2010), were synthesized by CPC Scientific [..]"
GhavamiNejad, A.; Lu, B.; Samarikhalaj, M.; Liu, J. F.; Mirzaie, S.; Pereira, S.; Zhou, L.; Giacca, A.; Wu, X. Y., Drug Delivery and Translational Research 2021, 1-13.
"PRL-2903 (PRL) was synthesized and purchased from CPC Scientific Inc. (San Jose, CA, USA)."
Zhang, T.; Xia, L.; Wang, Z.; Hancock, R. E.; Haapasalo, M., Journal of Endodontics 2021, 47 (3), 466-471.
"Peptides DJK-5 and 1018 were synthesized using solid-phase 9-fluorenylmethoxy carbonyl chemistry and purified to a purity of >95% using reverse-phase high-performance liquid chromatography by CPC Scientific (Sunnyvale, CA) as previously described [..]"
Spitz, A. Z.; Zacharioudakis, E.; Reyna, D. E.; Garner, T. P.; Gavathiotis, E., Nature Communications 2021, 12 (1), 1-15.
Hydrocarbon-stapled peptides corresponding to the BH3 domain of BIM, BIM SAHB: FITC-Ahx-EIWIAQELRS5IGDS5FNAYYA-CONH, where S5 represents the non-natural amino acid inserted for olefin metathesis, were synthesized and purified at >95% purity by CPC Scientific Inc.
Zeming, K. K.; Lu, R.; Woo, K. L.; Sun, G.; Quek, K. Y.; Cheow, L. F.; Chen, C.-H.; Han, J.; Lim, S. L. Analytical Chemistry 2021.
The FRET substrates used in this project are: neutrophil elastase substrate ((Z-AAAA)2Rh110 Abs/Em:497/520 nm, Anaspec), Granzyme B substrate (5TAMRA-VGPDFGR-K(QSY7)-NH2 Abs/Em: 546/580, CPC scientific), and metalloproteinase substrate (QSY21-HGDQMAQKSK(Cy5)-NH2 Abs/Em:649/666 nm, CPC Scientific).
DePalma, S. J.; Davidson, C. D.; Stis, A. E.; Helms, A. S.; Baker, B. M., Biomaterials Science, 2021, 9 (1), 93-107.
.. matrices were functionalized with cell adhesive peptides.. Gly-Phe-Hyp-Gly-Glu-Arg (GFOGER; CPC Scientific) via Michael-Type addition to available vinyl sulfone groups."
Zonari, A.; Brace, L. E.; Al-Katib, K. Z.; Porto, W. F.; Foyt, D.; Guiang, M.; Cruz, E. A. O.; Marshall, B.; Salgueiro, W. G.; Inan, M. D., bioRxiv 2020, 2020.10. 30.362822.
The top hits peptides selected (peptide 14, 144, 156, 195, and 393) from the screening were purchased from CPC Scientific Inc.
Pantua, H., Skippington, E., Braun, M.G., Noland, C.L., Diao, J., Peng, Y., Gloor, S.L., Yan, D., Kang, J., Katakam, A.K. and Reeder, J. MBio 11, no. 5 (2020): 10-1128.
- Departments of Infectious Diseases, OMNI Bioinformatics, Chemistry, Structural Biology, Biochemical and Cellular Pharmacology, Translational Immunology, Pathology, Molecular Biology, Genentech, South San Francisco, California, USA
MQLNKV-L(U13C6,15N)-KGL(U13C6,15N)MIALPVMAIAA-dipalmitoyl2C-SSNKNGG-K-biotin, which upon cleavage by LspA, yields the product peptide dipalmitoyl2C-SSNKNGG-K-biotin. A product standard [dipalmitoyl2C-SSNKNAAK-(NHCH2CH2NH)-biotin; CPC Scientific] was in the reaction mixture as an internal standard for normalization of product quantitation.
Curreli, Francesca, Sofia MB Victor, Shahad Ahmed, Aleksandra Drelich, Xiaohe Tong, Chien-Te K. Tseng, Christopher D. Hillyer, and Asim K. Debnath. Mbio 11, no. 6 (2020): e02451-20.
We have synthesized (CPC Scientific, Inc.) four stapled peptides, as depicted in Figure 2. We also synthesized the linear peptide, NYBSP-C, as a control. Besides, we purchased a linear peptide, SBP1, to use as a control, which was reported recently to bind to SARS-CoV-2 RBD with high affinity (KD = 47nM).
Abdulganiyyu, I. A.; Kaczmarek, K.; Zabrocki, J.; Nachman, R. J.; Marchal, E.; Schellens, S.; Verlinden, H.; Broeck, J. V.; Marco, H.; Jackson, G. E. Insect Biochemistry and Molecular Biology 2020, 103362.
A head-to-tail cyclic, octapeptide analog of Locmi-AKH-I, cycloAKH (cyclo[LNFTPNWG]) was synthesized to severely restrict the conformational freedom of the AKH structure.
Chan, Leslie W., Melodi N. Anahtar, Ta-Hsuan Ong, Kelsey E. Hern, Roderick R. Kunz, and Sangeeta N. Bhatia. Nature Nanotechnology (2020): 1-9.
HFA-modifed peptides were synthesized by CPC Scientifc (>95% purity). Briefy, the peptide substrate, Ac-CKKK(Cy5)-PEG4-Nle(O-Bzl)-Met(O)2-Oic-Abu-OH, was synthesized on Fmoc-Abu-CTC resin via standard Fmoc solid phase peptide synthesis.
Marion, Vincent, and Nikolai Petrovsky. U.S. Patent Application 16/627,389, filed July 9, 2020.
H-VECTM-R8-EKRVLA-S5-LDKPPFLTQLHS-OH (SEQ ID NO: 21) [..] H-VECTM-R8-EKRVLA-S5-LDKPPFLTQLHS-NH2 [..]
Belenkaya, S. V., A. A. Bondar, T. A. Kurgina, V. V. Elchaninov, A. Yu Bakulina, E. A. Rukhlova, O. I. Lavrik, A. A. Ilyichev, and D. N. Shcherbakov. Biochemistry (Moscow), 2020.
A synthetic peptide of the following composition was used as a substrate: Dabcyl-HPHPHLSFMAIPK (5-FAM) KK-NH2 (Dabcyl = 4-(dimethylaminoazo) benzene-4-carboxylic acid, 5-FAM = 5-carboxyfluorescein) (CPC Scientific, USA) containing the Chn-sensitive region of bovine κ-casein.
Hao, Liangliang, Renee T. Zhao, Chayanon Ngambenjawong, Heather E. Fleming, and Sangeeta Bhatia. bioRxiv (2020).
All peptides were chemically synthesized by CPC Scientific, Inc. [..] K(N3)-ANP-GPVPLSLVMGGC [..] 5FAM-GGf-Pip-KSGGGK(CPQ2)-PEG2-GC
Buss, Colin G., and Sangeeta N. Bhatia. Proceedings of the National Academy of Sciences (2020).
Tandem Peptides. Tandem peptides were purchased from CPC Scientific. Sequences are: mTP-TAMRA-LyP1 (Myr-GWTLNSAGYLLGKINLKALA-ALAKKILGGGGK(5TAMRA)-CGNKRTRGC (C-C bridge)); [..] PEGylated formulations of these peptides were synthesized as previously described (49). The sequences are: [..] mTP-PEG-ARAL (Myr-GWTLNSAGYLLGKINLKALA-ALAKKILC-PEG5K-GGGARALPSQRSR).
Kudryashev, Julia A., Lauren E. Waggoner, Hope T. Leng, Nicholas H. Mininni, and Ester J. Kwon. ACS Sensors (2020).
Calpain substrate peptide (QSY21-QEVYGAMP-K(Cy5)-PEG2-GC- NH2) was synthesized by CPC Scientific Inc. (Sunnyvale, CA …
Adem, Sandeep, Sonal Jain, Michael Sveiven, Xiahan Zhou, Anthony J. O’Donoghue, and Drew A. Hall. Scientific Reports 10, no. 1 (2020): 1-10
Biotin-PEG36-Thr-Phe-Ser-Tyr-Nle-Arg-Trp-Pro-PEG12-Cys (known as peptide) was synthesized by CPC Scientific..
Baba, Osamu, Andrew Elvington, Martyna Szpakowska, Deborah Sultan, Gyu Seong Heo, Xiaohui Zhang, Hannah Luehmann et al. bioRxiv (2020).
The FC131 peptide (cyclo[2-Nal-Gly-d-Tyr-NMe-d-Orn-Arg]) was synthesized by CPC Scientific (Sunnyvale, CA).
Vickers, Timothy A., Meghdad Rahdar, Thazha P. Prakash, and Stanley T. Crooke. Nucleic Acids Research (2019).
A solution of 1.5 umol SmBiT peptide (Val-Thr-Gly-Tyr-Arg-Leu-Phe-Glu-Glu-Ile-Leu-Gly-Gly-Ser-Gly-Gly-Lys(N3)-NH2) containing an azide group at the C-terminus (CPC Scientific, 1245 Reamwood Ave, Sunnyvale, CA, USA) in DMSO (0.5 ml) was added and the reaction mixture was stirred at room temperature for 5 h.
Lo, J.H., Hao, L., Muzumdar, M.D., Raghavan, S., Kwon, E.J., Pulver, E.M., Hsu, F., Aguirre, A.J., Wolpin, B.M., Fuchs, C.S. and Hahn, W.C. Molecular Cancer Therapeutics 17, no. 11 (2018): 2377-2388.
pTP-TAMRA-iRGD (CH3(CH)15-[GWTLNSAGYLLGKINLKALAALAKKIL-GGK(TAMRA)GGCRGDKGPDC, Cys-Cys bridge]) used in all figures except Fig. S1 was synthesized by CPC Scientific.
Ng, Ee Xien, Myat Noe Hsu, Guoyun Sun, and Chia-Hung Chen. Methods in Enzymology 628 (2019): 59-94.
The peptide sequences of the four FRET-based substrates ([..] CPC Scientific) are as follows: UV: AlexaFluor405-Leu-Ala-Gln-Ala-HompheArg-Ser-Lys (QSY35)-NH2; Blue: Dabcyl-Gly-Pro-Leu-Gly-Met-Arg-Gly-Lys (5-FAM)-NH2; Green: QSY7-Ala-Pro-Phe-Glu..
Artur Javmen, Vladimir Y. Toshchakov, et al. Journal of Leukocyte Biology (2019).
All CPDPs included the N‐terminal Antennapedia homeodomain sequence RQIKIWFQNRRMKWKK.38 The Cy3‐labeled peptides were produced by CPC Scientific (Sunnyvale, CA, USA). The Cy3 label was placed at the peptide N‐terminus..
Gilles, Maud-Emmanuelle, Slack, Frank J, et al. Oncotarget, 2019, Vol. 10, (No. 51), pp: 5349-5358
"Tandem peptide (pTP-iRGD: CH3(CH)15-GWTLNSAGYLLGKINLKALAALAKKIL-GGK(TAMRA)GGCRGDKGPDC, Cys-Cys bridge) was synthesized by CPC Scientific."
Garner, Thomas P., Dulguun Amgalan, Denis E. Reyna, Sheng Li, Richard N. Kitsis, and Evripidis Gavathiotis. Nature Chemical Biology 15, no. 4 (2019): 322.
"Hydrocarbon-stapled peptides corresponding to the BH3 domain of BIM, BIM SAHBA2: N-acetylated- and FITC-Ahx-EIWIAQELRS5IGDS5FNAYYA-CONH2, where S5 represents the non-natural amino acid inserted for olefin metathesis, were synthesized, purified at >95% purity by CPC Scientific Inc. and characterized as previously described."
Gibbs, Ebrima, Judith M. Silverman, Beibei Zhao, Xubiao Peng, Jing Wang, Cheryl L. Wellington, Ian R. Mackenzie, Steven S. Plotkin, Johanne M. Kaplan, and Neil R. Cashman. Scientific Reports 9, no. 1 (2019): 1-14.
The conformational epitope was synthesized as a cyclic peptide with additional N-terminal residues CG and a C-terminal G to recapitulate the predicted structure of HHQK on AβO. Peptide synthesis was performed by CPC Scientific Inc. (Sunnyvale CA, USA) [..] Cyclization was performed via a head-to-tail (C-G) amide bond and c[CGHHQKG] was then conjugated to either keyhole limpet hemocyanin (KLH) or bovine serum albumin (BSA) via maleimide-based coupling.
Bårdsen, Kjetil, Michaela D. Gjerstad, Markku Partinen, Ingeborg Kvivik, Anne Bolette Tjensvoll, Peter Ruoff, Roald Omdal, and Cato Brede. Analytical Chemistry 91, no. 14 (2019): 9323-9329.
Synthetic Hcrt1 with13Cand15N stabile isotopemodification on two leucine amino acids was used for internalstandard (ISTD) calibration; Glp-P-L(U13C6,15N)PDCCR-QKTCSCR-L(U13C6,15N)YELLHGAGNHAAGILTL-NH2(CPC Scientific, Sunnyvale, CA)
McGonigle, Sharon, Utpal Majumder, Donna Kolber-Simonds, Jiayi Wu, Andrew Hart, Thomas Noland, Karen TenDyke et al. Cell Communication and Signaling 17, no. 1 (2019): 67.
Native Cltx (Cltx-CONH2) was synthesized at CPC Scientific (Sunnyvale, CA) by routine methods and stored dry at -20 °C.
Lesniak, W. G.; Mease, R. C.; Chatterjee, S.; Kumar, D.; Lisok, A.; Wharram, B.; Kalagadda, V. R.; Emens, L. A.; Pomper, M. G.; Nimmagadda, S., Molecular Imaging 2019, 18, 1536012119852189.
The PD-L1-binding peptide, WL12 (sequence shown in Figure 1A), was custom synthesized by CPC Scientific (Sunnyvale, California) with >95% purity.
Mac, Quoc D., Dave V. Mathews, Justin A. Kahla, Claire M. Stoffers, Olivia M. Delmas, Brandon Alexander Holt, Andrew B. Adams, and Gabriel A. Kwong. Nature Biomedical Engineering 3, no. 4 (2019): 281.
"FITC-labelled GzmB substrate peptides with internal quencher ((5-FAM)aIEFDSGK(CPQ2)kkc) were synthesized by CPC Scientific and used for all in vitro activity assays."
Rohani, Nazanin, Anthony R. Soltis et al. Cancer Research 79, no. 8 (2019): 1952-1966.
100 ul of 40μM Cy7 labled pHLIP peptide (N->C: AC(Cy7)DDQNPWRAYLDLLFPTDTLLLDLLW-DLys-DLys synthesized by CPC Scientific, Inc.)..
Sasaki, Masako, Ken‐ichi Hamagami et al. Pharmacology Research & Perspectives 7, no. 5 (2019): e00517.
- Research, Takeda Pharmaceutical Company Limited, Fujisawa, Kanagawa, Japan
The substrates QSY21‐Gly‐Asp‐Asp‐Asp‐Lys‐Ile‐Val‐Gly‐Gly‐Lys(Cy5) and 5FAM‐Abu‐Gly‐Asp‐Asp‐Asp‐Lys‐Ile‐Val‐Gly‐Gly‐Lys(CPQ2)‐Lys‐Lys‐NH2 were purchased from CPC Scientific (Sunnyvale, CA).
Lee, Chul-Jin, Mitra S. Rana, Chanhyung Bae, Yan Li, and Anirban Banerjee. Journal of Biological Chemistry 294, no. 1 (2019): 231-245.
Substrate-mimicking peptides for wild-type or mutant Wnts with a point-mutation, varying in lengths or the number of disulfide bonds were purchased from CPC Scientific (Sunnyvale, CA)..
Melgar-Asensio, Ignacio, et al. Investigative Ophthalmology & Visual Science 59.10 (2018): 4071-4081.
Thio-peptide: NH2-Cys-PEG4-Sar-YNLYRVRS-NH2, MW 1,490 g/mol was custom synthesized, via solid state methods by CPC Scientific (Sunnyvale, CA, USA).
Hornigold, D.C., Roth, E., Howard, V., Will, S., Oldham, S., Coghlan, M.P., Blouet, C. and Trevaskis, J.L. Appetite 127 (2018): 334-340.
- Cardiovascular and Metabolic Diseases, MedImmune Ltd, Milstein Building, Granta Park, Cambridge, CB21 6GH, UK
- University of Cambridge, Department of Clinical Biochemistry, MRC Metabolic Diseases Unit, Addenbrooke's Hospital, Cambridge, CB2 0QQ, UK
- Cardiovascular and Metabolic Diseases, MedImmune LLC, One MedImmune Way, Gaithersburg, MD 20878, USA
AC3174 (Amylin Pharmaceuticals) is a functional analog of exenatide (Hargrove et al., 2007). AC170222 (Hpa-Nle-Gly-Trp-Lys(Tac)-Asp-NMePhe-NH2; CPC Scientific, Sunnyvale, CA) is a CCKR1-selective peptide (Pierson et al., 2000).
Hewings, D.S., Heideker, J., Ma, T.P., AhYoung, A.P., El Oualid, F., Amore, A., Costakes, G.T., Kirchhofer, D., Brasher, B., Pillow, T. and Popovych, N. Nature Communications 9, no. 1 (2018): 1162.
- Discovery Oncology, Genentech, South San Francisco, California, 94080, USA
- Early Discovery Biochemistry, Genentech, South San Francisco, California, 94080, USA
The 5-TAMRA (5-Carboxytetramethylrhodamine) peptide was generated by CPC-Scientific consisting of the sequence 5-TAMRA-YPYDVPDYAIREIVSRNKRRYQEDG. K63 or K48 tetra-Ub chains were conjugated to the peptide via its lysine residue [..]
Nuss, Andrew B., and Mark R. Brown. General and Comparative Endocrinology (2017).
"A bioactive form of AaILP3 (norLeu substituted for Met) was synthesized in the laboratory (Brown et al., 2008) and later by CPC Scientific, Inc. (Sunnyvale, CA). [..] stephensi ILP3 and ILP4 (CPC Scientific, Inc.)"
Nakagawa, Mayumi. U.S. Patent Application 15/552,285, filed February 15, 2018.
“The PepCan peptide mixture will contain four HPV 16 E6 peptides: E6 1-45 (Ac-MHQKRTAMFQDPQER PRKLPQLCTELQTTIHDIILECVYCKQQLL-NH2..), E6 46-80 (Ac-RREVYDFAFRDLCIV YRDGN PYA VCDKCLKFYSKI-NH2..), E6 81-115 (Ac-SEYRHYCYSLYGTTLEQQYNK PLCDLLIRCINCQK-NH2..), and E6 116-158 (Ac-PLCPEEKQRHLDKKQRFHNIRGRWT GRCMSCCRSSRTRRETQL-NH2..) (U.S. Pat. No. 8,652,482). Commercially produced cGMP-grade peptides (CPC Scientific, San Jose, Calif.) will be examined..”
Dekker, Petrus Jacobus Theodorus, René Marcel De Jong, and Cornelis Marinus Muijlwijk. U.S. Patent Application No. 14/397,866.
"The internal standard (ISTD) WIL*GDVFIREYYSV*FDR was ordered from CPC Scientific (Sunnyvale, Calif., USA) and contained L*6×13C 1×15N and V*5×13C 1×15N. The ISTD contained an internal trypsin cleavage site in order to monitor the digestion with trypsin to completion."
Wuerth, Kelli C., Reza Falsafi, and Robert EW Hancock. PloS One 12, no. 11 (2017): e0187565.
"LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2) was purchased from CPC Scientific (Sunnyvale, California, USA).."
Kategaya, L., Di Lello, P., Rougé, L., Pastor, R., Clark, K.R., Drummond, J., Kleinheinz, T., Lin, E., Upton, J.P., Prakash, S. and Heideker, J. Nature 550.7677 (2017): 534.
- Departments of Discovery Oncology, Early Discovery Biochemistry, Structural Biology, Discovery Chemistry, Biochemical and Cellular Pharmacology, Protein Chemistry, Microchemistry, Proteomics, and Lipidomics, Research Pathology, Bioinformatics and Computational Biology, and Translational Oncology, Genentech, South San Francisco, 94080, California, USA
- Department of Pharmaceutical Chemistry and Small Molecule Discovery Center, University of California, San Francisco, San Francisco, 94143, California, USA
- MRC Protein Phosphorylation and Ubiquitylation Unit, School of Life Sciences, University of Dundee, Dundee, DD1 5EH, UK
- Institute for Cell and Molecular Biosciences, Newcastle University, Newcastle upon Tyne, NE2 1HH, UK
"The 5-TAMRA (5-carboxytetramethylrhodamine) peptide was generated by CPCScientific consisting of the sequence 5-TAMRA-YPYDVPDYAIREIVSRNKRRYQEDG.."
Boehm, M., Beaumont, K., Jones, R.M., Kalgutkar, A.S., Zhang, L., Atkinson, K., Bai, G., Brown, J.A., Eng, H., Goetz, G.H. and Holder, B.R. Journal of Medicinal Chemistry (2017).
- Pfizer Worldwide Research & Development, Cambridge, Massachusetts 02139, United States
- Pfizer Worldwide Research & Development, Groton, Connecticut 06340, United States
The chemokine receptor CXCR7 is an attractive target for a variety of diseases. While several small-molecule modulators of CXCR7 have been reported, peptidic macrocycles may provide advantages in terms of potency, selectivity, and reduced off-target activity
Bainbridge, Travis W., et al. Scientific Reports 7.1 (2017): 12524.
- Protein Chemistry, Molecular Oncology, Discovery Chemistry, Cancer Immunology, and Neuroscience. Genentech Inc., South San Francisco, CA, 94080, USA
"ANP FAP and aP NIRF were synthesized by CPC Scientific (Sunnyvale, CA)… Another internally-quenched FRET peptide substrate (ANPFAP) for FAP has recently been reported and demonstrated for use as an activity-based, in vivo imaging tool. The peptide sequence contains two internal Gly-Pro dipeptide motifs, susceptible to FAP cleavage and a Cy5.5/QSY21, quenched-FRET pair."
Coorens, Maarten, et al. The Journal of Immunology 199.4 (2017): 1418-1428.
"CATH-2 and LL-37 were synthesized by Fmoc-chemistry at CPC Scientific (Sunnyvale, CA)."
Wilson, Sarah S., et al. PLoS Pathogens 13.6 (2017): e1006446.
"Cryptdin 2 (UniProtKB: P28309, LRDLVCYCRTRGCKRRERMNGTCRKGHLMYTLCCR)... obtained by oxidative refolding of partially purified linear peptides (synthesized by CPC Scientific...) and purifying the correctly folded species by reverse-phase high-pressure liquid chromatography (RP-HPLC). Purity was determined by analytical RP-HPLC, and the mass of the disulfide-bonded peptides was verified by high mass accuracy liquid chromatography-mass spectrometry."
Sattiraju, A., et al. Oncotarget 2017, 8 (26), 42997-43007.
For Ac-225 labeling, the prepared DOTA-Pep-1L (CPC-scientific, San Jose, CA) was incubated with Ac-225 at 70°C for 50 minutes. The TLC plates were scanned on a BioScan Imaging Scanner. Cu-64 was purchased from Washington University in St. Louis. The custom peptide specific to IL13RA2 and a scrambled peptide were conjugated with NOTA by CPC scientific Inc (San Jose, CA). Both the peptides, Pep-1L and scrambled peptide-NOTA were radiolabeled with Cu-64 according to the previously reported methods [15].
Puthenveetil, Sujiet, et al. PloS One 12.5 (2017): e0178452.
- Worldwide Medicinal Chemistry, Pfizer Global R&D, Groton, Connecticut, United States of America.
- Pfizer Oncology Research, Pearl River, NY, United States of America.
"Peptide-payload conjugate (7) was prepared by reacting 2mM aizoacetyl-Ser-Lys-Gly-Ser-Lys (CPC scientific, inc. Sunnywale, CA) with 8 mM NHS-ester payload [19] in 50% Dimethyl sulfoxide (DMSO), 50 mM borate buffer pH 8.5 for 2 h at 37°C."
Kwon, Ester J., et al. Advanced Materials 29.35 (2017).
"[..] synthesized for initial screening with FAM-conjugated lysine at the C-terminal end of the membrane-interactive peptide and with or without D[KLAKLAK]2 on the C-terminus using standard Fmoc chemistry[..] All peptides were synthesized with N-terminal myristic acid and C-terminal amine. [..] larger quantities of the peptides were synthesized by CPC Scientific to 90% purity"
Noland, Cameron L., et al. Proceedings of the National Academy of Sciences 114.30 (2017): E6044-E6053.
- Departments of Structural Biology, Infectious Diseases, Biochemical and Cellular Pharmacology, Pathology, Translational Immunology, and Biomolecular Resource Group, Genentech, Inc., South San Francisco, CA 94080.
"..peptide substrates were synthesized based on the Pal lipoprotein, Pal peptideshort (Pam2Cys-SSNKNGGK-Biotin; CPC Scientific, Inc.).."
Marquez, B. V., et al. J Nucl Med 2014, 55 (6), 1029-34.
"L19K was synthesized by CPC Scientific and comprised the sequence NO2A-PEG4-GGNECDIARMWEWECFERK-CONH2, with Cys-Cys disulfide bridge and polyethylene glycol (PEG4) as a spacer between peptide and chelator. "
Gavathiotis, E., Albert Einstein College of Medicine, 2017. U.S. Patent Application 15/311,861.
"Hydrocarbon-stapled peptide corresponding to the BH3 domain of BIM, BIM SAHBA2: N-acetylated 145EIWIAQELRS5IGDS5FNAYYA164-CONH2 (SEQ ID NO:2), where S5 represents the non-natural amino acid inserted for olefin metathesis, was synthesized, purified and characterized as previously described by CPC Scientific (11)."
Kwon, Ester J., Jaideep S. Dudani, and Sangeeta N. Bhatia. Nature Biomedical Engineering 1 (2017): 0054.
[..] MMP substrate, 5-FAM–GGPLGVRGKK(CPQ2)–PEG2–C; thrombin substrate, 5-FAM–GGfPRSGGGK(CPQ2)–PEG2–C; where 5-FAM is the 5-carboxyfluorescein fluorophore, CPQ2 is the quencher, PEG2 is the linker polyethylene glycol, [..] dye for urinary detection (biotin–CGPLGVRGKK(Cy7)eGvndneeGffsar; Cy7 is cyanine7). Targeting peptides were [..] cyclized: LyP1, C–K(5-FAM)–C6–CGNKRTRGC; iRGD, C–PEG2–CRGDKGPDC; where C6 is the 6-aminohexanoic acid linker [..]
Weaver, Clarissa L., et al. Biochemistry 56.15 (2017): 2071-2075.
"The peptide, NCysRepA50mer (C MNQSFISDIL YADIESKAKE LTVNSNNTVQ PVALMRLGVF VPKPSKSKGE), was synthesized by CPC Scientific (Sunnyvale, CA). "
Huang, Chung-Guei, et al. Oncotarget 8.21 (2017): 34820-34835
"Synthetic peptides of HPV 16 L1 (N′-C-KHTPPAPKEDPLKK-C′; position: 456−471)/E6 (N′-C-RTAMFQDPQERPRK-C′; position: 5−18) and a recombination protein of full-length HPV 16 E7-histag fusion protein (N′-MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEED-EIDGPAGQAEPDRAHYNIVTFCCKCDSTLRL-CVQSTHVDIRTLEDLLMGTLGIVCPICSQKP-C′; position: 1−98) were manufactured by CPC Scientific Inc."
Wang, X., Kurowski, S., Wu, W., Castriota, G.A., Zhou, X., Chu, L., Ellsworth, K.P., Chu, D., Edmondson, S., Ali, A. and Andre, P. Journal of Pharmacology and Experimental Therapeutics 360, no. 3 (2017): 476-483.
- Departments of Cardiometabolic Disease Biology, Discovery Pharmaceutical Sciences, In Vitro Pharmacology, and Discovery Chemistry, Merck Research Laboratories, Kenilworth, New Jersey.
- Lead Optimization Chemistry, Merck Research Laboratories, Rahway, New Jersey.
The 7-amido-4-thifluoromethylcoumarin (AFC) containing fluorescence substrate, CH3SO2-cyclohexyl-Gly-Gly-Arg-AFC (cyclohexyl-G-G-R-AFC) was custom synthesized by CPC Scientific (Sunnyvale, CA, USA)..
Barbieri, Christopher M., et al. Journal of Pharmacology and Experimental Therapeutics 360.3 (2017): 466-475.
- In Vitro Pharmacology and Cardiometabolic Diseases, Merck & Co., Inc., Kenilworth, New Jersey
"The 7-amido-4-thifluoromethylcoumarin (AFC) containing fluorescence substrate, CH3SO2-cyclohexyl-Gly-Gly-Arg-AFC (cyclohexylG-G-R-AFC) was custom synthesized by CPC Scientific (Sunnyvale, CA, USA)"
Joshi, Bishnu P., et al. Endoscopy 48.02 (2016): A1-A13
"ASY*-FITC was synthesized using good manufacturing practice (GMP) methods (CPC Scientific, Inc.). Stability was evaluated on high-performance liquid chromatography (HPLC) and mass spectrometry.”
Chatterjee, Samit, et al. Biochemical and Biophysical Research Communications 483.1 (2017): 258-263.
PD-L1 binding peptide, WL12, was custom synthesized by CPC Scientific (Sunnyvale, CA) with >95% purity.
Novel theranostic nanoporphyrins for photodynamic diagnosis and trimodal therapy for bladder cancer.
Lin, Tzu-Yin, et al. Biomaterials 104 (2016): 339-351.
"Our previously reported PLZ4-PEG 5k -CA 8 telodendrimer was synthesized by the conjugation of alkyne-derivatized bladder cancer targeting ligand PLZ4 (CPC Scientific, Sunnyvale, CA)"
Espejo, Alexsandra B., et al. Journal of Biological Chemistry 292.6 (2017): 2255-2265.
"PRMT5pT634 (Biotin-SAIHNPTGRSYpTIGL-COOH, where pT represents phosphothreonine), PGHS2 (Biotin-SGSGVLIKRRSTEL-COOH),PGHS2pT602 (Biotin-SGSGVLIKRRSpTEL-COOH), IRK1 (Biotin-SGSGPRPLRRESEI-COOH), IRK1pS425 (BiotinSGSGPRPLRREpSEI-COOH, where pS represents phosphoserine), ERBB4 (Biotin-GTVLPPPPYRHRNTVV-COOH), and ERBB4pT1306 (Biotin-GTVLPPPPYRHRNpTVV-COOH)) and by CPC Scientific, Inc. (E6 (HPV16) (Biotin-RSSRTRRETQLCOOH) and E6 (HPV16)pT156 (Biotin-RSSRTRREpTQLCOOH))."
Ayhan, Dilay Hazal, et al. PLoS Biol 14.9 (2016): e1002552.
"The cell-penetrating peptide (RXR)4XB, where R is arginine, X is aminohexanoic acid, and B is beta-alanine, was synthesized using standard FMOC chemistry and purified to >95% purity at CPC Scientific (Sunnyvale, CA) and used without further purification."
Lo, Justin H., et al. Bioconjugate Chemistry (2016).
"Myristoyl-transportan−LyP-1 tandem peptide was synthesized by CPC Scientific (sequence: myr-GGWTLNSAGYLLGKINLKALAALAKKIL-GGGG-CGNKRTRGC, Cys−Cys bridge). FAM-labeled LyP-1 bearing an azide (azidoacetyl-GGG-cyclo-(EGNKRTRGK)), FAM-labeled LyP-1 bearing a cysteine (C-K(5FAM)-C6-cyclo-(CGNKRTRGC)) and transportan bearing a C-terminal cysteine (myristic acid-GGWTLNSAGYLLGKINLKALAALAKKILC) were synthesized by CPC Scientific, Inc."
Graaf, Matthew D., et al. ACS Chemical Biology (2016).
"Cu(I)-catalyzed “click” reactions cannot be performed on a borate ester derived polymer coating on a microelectrode array because the Cu(II) precursor for the catalyst triggers background reactions between both acetylene and azide groups with the polymer surface. [..] The new chemistry can be used to explore new biological interactions on the arrays. Specifically, the binding of a v107 derived peptide with both human and murine VEGF was probed using a functionalized microelectrode array."
Hershey, David M., et al. BioRxiv (2016): 047555.
"A custom peptidewith the sequence 5-carboxymethylfluorescein-Thr-Gln-Thr-Val-Ala-Ala-Gly-Ser-Lys(CPQ2)-D-Arg-D-Arg was obtainedcommercially (CPC Scientific)"
LaRock, Christopher N., et al. Science Immunology 100.200: 300 (2016).
"Internally quenched peptides of the sequences of IFFDTWDNE, TWDNEAYVH, EAYVHDAPV, and HDAPVRSLN, corresponding to amino acids 103 to 111, 107 to 115, 111 to 119, and 115 to 123 of the reference human pro–IL-1b sequence (UniProt: P01584), were labeled on the N terminus with Mca and on the C terminus with Lys-Dnp (CPC Scientific)."
Chen, Long, et al. Scientific Reports 6 (2016).
- Beijing National Laboratory for Molecular Sciences, College of Chemistry and Molecular Engineering, Synthetic and Functional Biomolecules Center, Peking University, Beijing 100871, China
- Department of Global Biotherapeutics Technologies, Pfizer Inc., Cambridge, MA 02140, USA
- School of Life Sciences, Nanjing University, China
- Peking-Tsinghua Center for Life Sciences, Beijing, China
"The Biotin-C6-LELPETGG-NH2, GGGY-Lys(Biotin)-NH2, and GGG-Lys(N3)-NH2 reagents were synthesized by CPC Scientific."
Goupil, Louise S., et al. PLoS Negl Trop Dis 10.8 (2016): e0004893.
"Protease activity in regurgitant from three replicate tanks were compared using a mixture of 7 internally quenched fluorescent substrates available from CPC Scientific, Sunnyvale, California (Table 1) [AMYD-112, AMYD-114, AMYD-109, MMPS-024, SUBS-017, AMYD-111, CASP-060]. These substrates were chosen based on their diverse sequence composition to enable detection of multiple protease classes."
Garner, Thomas P., et al. Molecular Cell 63.3 (2016): 485-497.
"Hydrocarbon-stapled peptide corresponding to the BH3 domain of BIM, BIM SAHBA: N-acetylated 145EIWIAQELRS5IGDS5FNAYYA164-CONH2, where S5 represents the non-natural amino acid inserted for olefin metathesis, was synthesized, purified and characterized as previously described by CPC Scientific (Gavathiotis et al., 2008)."
Karlsson, Erik A., et al. mBio 7.4 (2016): e01144-16.
"Peptides 20 amino acids in length spanning the HA and NA proteins of the A/Anhui/1/2013 (H7N9) virus were generated with 15-amino-acid overlaps, resulting in the synthesis of 110 HA peptides and 90 NA peptides synthesized at >90% purity (CPC Scientific). A small number of peptides were synthesized at >70% purity, following multiple synthesis and purification attempts. A poly(K) linker was added to each peptide to increase solubility and to improve the binding orientation of peptides to the Hydrogel slides."
Fumakia, M. MS Thesis, University of Manitoba 2016.
LL37 (host defense peptide) (Table 2) was a purchased from (custom synthesized by CPC Scientific Inc., CA, USA)
Kwon, Ester J., Matthew Skalak, Riana Lo Bu, and Sangeeta N. Bhatia. ACS Nano 10, no. 8 (2016): 7926-7933.
"[The peptides] were synthesized by CPC Scientific with N-terminal myristic acid."
Cox, J.M., Berna, M.J., Jin, Z., Cox, A.L., Sloop, K.W., Gutierrez, J.A. and Ackermann, B.L. Bioanalysis 8, no. 15 (2016): 1579-1595.
- 1 Lilly Research Laboratories, Eli Lilly & Company, Lilly Corporate Center, Indianapolis, IN 46285, USA.
"The OXM peptides 1–37, 3–37 and 4–37 as well as their corresponding stable isotope-labeled internal standards (each containing one [ 13 C 9 , 15 N]-labeled phenylalanine and two [ 13 C 6 , 15 N]-labeled leucine residues) were synthesized by CPC Scientific, Inc."
Cuperus, T., van Dijk, A., Matthijs, M.G., Veldhuizen, E.J. and Haagsman, H.P. Scientific Reports 6, no. 1 (2016): 26622.
"D-CATH-2 (amino acid sequence: RFGRFLRKIRRFRPKVTITIQGSARF-NH2) and N-terminally FITC and TAMRA labeled peptides were generated by solid-phase synthesis using Fmoc-chemistry and purified to >95% purity by RP-HPLC by CPC Scientific Inc. (Sunnyvale, USA…"
Leclair, E., Liggins, R.T., Peckett, A.J., Teich, T., Coy, D.H., Vranic, M. and Riddell, M.C. Diabetologia (2016): 1-8.
"The SSTR2a (PRL-2903) was purchased by CPC Scientific (Sunnyvale, CA, USA) and the dose (10 mg/kg body mass) approximated that given in our prior studies [25–27]. The antagonist was dissolved in saline and given in a 2 ml/kg volume."
Pandya, Darpan N., et al. Theranostics 6.5 (2016): 698.
DOTA-c(RGDyK) was purchased from CPC Scientific, Inc. (Sunnyvale, CA), and its purity and mass were confirmed at Wake Forest using HPLC and electrospray ionization (ESI) mass spectrometry as described below.
Zhen, Eugene Y., et al. Biochemical Journal (2015): BJ20151085.
- Lilly Research Laboratories, Lilly Corporate Center, Indianapolis, IN 46285, U.S.A
"Stable isotope-labelled (SIL) peptides were synthesized by CPC Scientific. Leucine residues were selectively labeled using 13C/15N-labelled amino acids resulting in the addition of 7 Da to the peptide mass (Supplementary Table S1). The reported purity of each synthesized peptide was more than 95% based on HPLC analysis. "
Lopez, A., Reyna, D.E., Gitego, N. et al. Co-targeting of BAX and BCL-XL proteins broadly overcomes resistance to apoptosis in cancer. Nat Commun 13, 1199 (2022).
- Cardio-metabolic Disease Biomarkers, Merck Research Laboratories, Kenilworth, NJ., Merck & Co., Inc.
"Glucagon synthetic peptide and heavy isotope–labeled internal standards (ISs) of oxyntomodulin and glucagon containing 2 [ 13 C 6 - 15 N]-labeled leucines and 1 [ 13 C 9 - 15 N]-labeled phenylalanine were synthesized by CPC Scientific.."
Dudani, Jaideep S., et al. ACS Nano 9.12 (2015): 11708-11717.
"...protease activity are focused on functionalizing synthetic peptide substrates with reporters that emit ... In vivo, veiled nanosensors are selectively activated at the ..... sized by CPC Scientific, Inc. (V1: Biotin-PEG(5 kDa)-(KFAM)-..."
Kwong, Gabriel A., et al. Proceedings of the National Academy of Sciences 112.41 (2015): 12627-12632.
"Cysteine-terminated peptides (Q1 = 5FAM-GGPLGVRGKK(CPQ-2)-PEG2-C, CPC Scientific.."
Martinez, R., Blasina, A., Hallin, J.F., Hu, W., Rymer, I., Fan, J., Hoffman, R.L., Murphy, S., Marx, M., Yanochko, G. and Trajkovic, D. PloS One 10, no. 9 (2015): e0138616.
- Oncology Research Unit, Pfizer Worldwide Research and Development, 10724 Science Center Drive, San Diego, CA, 92121
The 60 minute enzymatic reaction contained 5 nM Mps1 catalytic domain (aa 510–857), 60 μM (~Km-level) ATP, 5 μM phosphoacceptor peptide substrate (5FAM-RQRRSIDDTIDSTRLFE-NH2; CPC Scientific, Sunnyvale, CA), 10 mM MgCl2, 4% DMSO (with or without inhibitor), 1 mM DTT, 0.01% Tween-20, 50 mM HEPES (pH 7.5).
Zhu, Shu, et al. Blood 126.12 (2015): 1494-1502.
"The custom-made thrombin-sensitive peptide azidoacetyl-AK(5FAM)-GALVPRGSAGK(CPQ2)-NH2 was obtained from CPC Scientific (Sunnyvale, CA) for click reactions to anti-CD61, as previously described."
Fu, Shushu, et al. Microbes and Infection 17.9 (2015): 665-670.
"The peptides P20A (Ac-AAASGINAEWPLWPGEAGWGRLEGRRTYEAEI-NH 2 ) and biotin-P20A (biotin-PEG4-AAASGINAEWPLWPGEAGWGRLEGRRTYEAEI-NH2 ) were synthesized by CPC Scientific."
Nakagawa, Mayumi. U.S. Patent Application No. 14/566,604, filed August 13, 2015.
“To define the minimal and optimal amino acids sequences of the CD8 T-cell epitope, 8-mer, 10-mer, 11-mer, and homologous peptides were synthesized (CPC Scientific, Inc, San Jose, Calif.)… Their safety for human use is ensured, in accordance with FDA requirements…(each peptide to be assessed individually […]
Miles, Linde A., et al. PloS One 10.6 (2015): e0129103.
"Peptides corresponding to the substrate sequences L/VP4.1 and non-hydrolysable linker (NHL) were synthesized between a 5-carboxyfluorescein (5-FAM) fluorophore/CPC Quencher (CPQ2) quencher pair (CPC Scientific). Additional lysines were added for increased solubility giving final peptide sequences of CPQ2-IVYELQGP-K(5FAM)-KK-NH2 and CPQ2-GGSGGS-K(5FAM)-KK-NH2 for L/VP4.1 and NHL, respectively. The identity and sequence of the L/VP4.1 and NHL peptides were confirmed by CPC Scientific via LC-MS and determined to be 96.7% and 95.1% pure, respectively."
Jensen, Jesper Langholm, et al. Journal of Dairy Science 98.5 (2015): 2853-2860.
"... Dabcyl-HPHPHLSFMAIPK(5-FAM)KK-NH 2 (98% purity; Figure 1) was purchased from CPC Scientific (Sunnyvale, CA). ..."
Shi, Jing, et al. Journal of Food Science 80.6 (2015): E1202-E1208.
"The cleavage preference of AGP was tested using an E(Edans)-AAXAAK-(Dabcyl)-NH 2 fluorescent substrate kit (CPC Scientific Inc., Calif., USA) with “A” representing alanine residues, “K” lysine residues, and “X” different individual amino acid residues as specified by their one ..."
Ren, Yin, and Sangeeta N. Bhatia. U.S. Patent No. 9,006,415. 14 Apr. 2015.
"The tandem peptide library used in this work was synthesized via standard FMOC solid-phase peptide synthesis and purified by high-performance liquid chromatography at the MIT Biopolymers Core, Tufts University Core Facility or CPC Scientific, Inc."
Pemovska, T., Johnson, E., Kontro, M., Repasky, G.A., Chen, J., Wells, P., Cronin, C.N., McTigue, M., Kallioniemi, O., Porkka, K. and Murray, B.W. Nature 519, no. 7541 (2015): 102-105.
- La Jolla Laboratories, Pfizer Worldwide Research & Development, San Diego, California 92121, USA.
The reactions were conducted in 50 ml volumes in 96-well plates and contained GST-tagged human-recombinant ABL1(T315I) kinase intracellular domain (1 nM), 3 mM phosphoacceptor peptide, 59 FAM- EAIYAAPFAKKK-OH (CPC Scientific, also known as ProfilerPro Peptide 2, Caliper Life Sciences), test compound (11-dose threefold serial dilutions, 2% DMSO final) or DMSO only, 1 mM dithiothreitol (DTT), 0.002% Tween-20 and 5 mM MgCl2 in 25 mM HEPES, pH 7.1
Wiens, Mayim E., and Jason G. Smith. "Alpha-defensin HD5 inhibits furin cleavage of human papillomavirus 16 L2 to block infection." Journal of Virology 89, no. 5 (2015): 2866-2874.
"Folded HD5 was made from a synthesized 80% pure linearized peptide (CPC Scientific, Sunnyvale, CA) and purified by reverse-phase high-pressure liquid chromatography, and an HD5 derivative containing L-α-aminobutyric acid in place of cysteine (HD5 Abu) was chemically synthesized, as previously described.."
Vanderpool, D., Grimshaw, C.E., Lawson, J.D. and Ermolieff, J. Analytical Biochemistry 473 (2015): 46-52.
- Enzymology and Biophysical Chemistry Group, Takeda California, San Diego, CA 92121, USA
- Computational Sciences and Crystallography Group, Takeda California, San Diego, CA 92121, USA
The mobility shift assay substrate (5-FAM-IPTSPITTTYFFFKKK) was purchased from CPC Scientific (Sunnyvale, CA, USA).
Adam, G.C., Meng, J., Rizzo, J.M., Amoss, A., Lusen, J.W., Patel, A., Riley, D., Hunt, R., Zuck, P., Johnson, E.N. and Uebele, V.N. Journal of Biomolecular Screening 20, no. 2 (2015): 212-222.
- Screening and Protein Sciences, Merck Research Labs, North Wales, PA, USA
Plates were incubated for 210 min at 25 °C followed by quenching with 25 uL water with 2% formic acid containing 600 nM of the internal standard with the sequence KTEEISEVN[L-U7]-OH (CPC Scientific).
Doron L, Coppenhagen-Glazer S, Ibrahim Y, Eini A, Naor R, Rosen G, Bachrach G. PLoS One. 2014 Oct 30;9(10):e111329.
"Fusolisin’s restriction specificity was verified using the FRET substrate CPQ2-Gly-Phe-Ile-Thr-Ala-Phe-Pro-Lys-(5FAM)-Arg-Arg-NH2 that was custom synthesized by CPC Scientific (Sunnyvale, CA, USA)."
Longo, Edoardo, et al. International Journal of Pharmaceutics 472.1 (2014): 156-164.
"[palmitoylated peptides] were synthesized by CPC Scientific Inc. (Sunnyvale, CA, USA), each obtained as a white lyophilised powder and stored at 4 °C protected from light. All peptides were synthesized by peptide solid-phase synthesis."
Warren, Andrew D., et al. Journal of the American Chemical Society 136.39 (2014): 13709-13714.
"Thrombin-sensitive reporter 1 (R1) was synthesized by CPC Scientific, with the sequence Biotin-PEG5kDa-Lys(5FAM)-Gly-Gly-DPhe-Pro-Arg-Ser-Gly-Gly-Gly-Cys, where PEG5kDa is 5 kDa poly(ethylene glycol)."
Saenz, Rebecca, et al. J Translational Medicine 12 (2014): 211.
“…Hp91 (DPNAPKRPPSAFFLFCSE), Hp121 (SIGDVAKKLGEMWNNTAA), scrambled Hp91 (ASLAPPFPNCFDPKSREF), and OVA-I (SIINFEKL) were all synthesized at GMP facilities by [..] CPC Scientific (San Jose, CA, USA). Peptides were synthesized with an N-terminal biotin, acetyl, or fluorescent tag (Cp488) as indicated in the figure legends. Peptides were routinely synthesized with greater than 95% purity.”
Wilson, Sarah S., et al. Mucosal Immunology 8.2 (2015): 352-361.
"Folded Crp23 was created from a synthesized 80% pure linear peptide (CPC Scientific, Sunnyvale, CA) by the same procedure as previously reported for the α-defensin HD5"
Ng, Quinn KT, et al. Biomaterials 35.25 (2014): 7050-7057.
"Linear and cyclic targeting sequences of the peptides CCVVVT-EG4-GRGDSP-NH2 (97%) (Cap-lRGD) and c[RGDfK(CCVVVT-EG 4 )] (96%) (Cap-cRGD) were purchased from CPC Scientific."
Harper, Brett, Mahsan Miladi, and Touradj Solouki. Journal of The American Society for Mass Spectrometry 25.10 (2014): 1716-1729.
"antipeptide (EGVYVHPV), angiotensin II, human (DRVYIHPF), and isotopically (13C) labeled heptapeptide (AAAAHAA-NH2 [where “A” indicates a carbon thirteen (13C) isotope on the alanine carbonyl group]) were purchased from CPC Scientific Incorporated (Sunnyvale, CA)"
Choi, Ka-Yee G., Scott Napper, and Neeloffer Mookherjee. Immunology 143.1 (2014): 68-80.
"Peptides LL-37 ([LL-37, 37 aa]), a scrambled LL-37, sLL-37 (RSLEGTDRFPFVRLKNSRKLEFKDIKGIKREQFVKIL) and IG-19 (IGKEFKRIVQRIKDFLRNL-NH2) were obtained from CPC Scientific (Sunnyvale, CA). The peptides were re-suspended in endotoxin-free water and stored at −20° until needed."
Huang, Q., Johnson, T.W., Bailey, S., Brooun, A., Bunker, K.D., Burke, B.J., Collins, M.R., Cook, A.S., Cui, J.J., Dack, K.N. and Deal, J.G. Journal of Medicinal Chemistry 57, no. 4 (2014): 1170-1187.
- La Jolla Laboratories, Pfizer Worldwide Research and Development, 10770 Science Center Drive, San Diego, California 92121
The reactions were conducted in 50-μL volumes in 96-well plates and contained 1.3 nM wild-type or 0.5 nM mutant ALK, 3 μM phosphoacceptor peptide (5′FAM-KKSRGDYMTMQIG-CONH2, synthesized by CPC Scientific, Sunnyvale, CA)..
Skjevik, Åge Aleksander, et al. Journal of Molecular Biology 426.1 (2014): 150-168.
"The peptides TH-(1-43) (MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIE) and THp-(1-43) (MPTPDATTPQAKGFRRAVS(PO3)2-ELDAKQAEAIMSPRFIGRRQSLIE) were synthesized by CPC Scientific (San Jose, CA) at approximately 90% purity, as seen by mass spectroscopy, and used without further purification."
Yu, Yang, et al. Science China Life Sciences 57.1 (2014): 117-127.
"The peptides, shown in Figure 1, were designed and synthesized. MPER (RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR), TT peptide (FNNFTVSFWLRVPKVSASHLE), T10HE peptide (FNNFTVSFWLRVPKVSASHLE-PEG2-LWNWF-S5-ITN-S5-LWYIR-PEG2-KK), and T10E peptide (FNNFTVSFWLRVPKVSASHLEPEG2-LWNWFDITNWLWYIR-PEG2-KK) were purchased from CPC Scientific Inc. (Sunnyvale, CA, USA)."
Zekavat, Behrooz, et al. J. Am. for Mass Spectrometry 25.2 (2014): 226-236.
"The synthesized cyclo-(RPKPQQFFGL) peptide and human angiotensin II were purchased from CPC Scientific (CPC Scientific Inc., Sunnyvale, CA, USA)."
Xu, Y., Cai, T.Q., Castriota, G., Zhou, Y., Hoos, L., Jochnowitz, N., Loewrigkeit, C., Cook, J.A., Wickham, A., Metzger, J.M. and Ogletree, M.L. Thrombosis and Haemostasis 111, no. 04 (2014): 694-704.
- Departments of Thrombosis, Cardiometabolic Diseases and In Vivo Pharmacology, Merck Research Laboratories, Kenilworth, New Jersey, USA
CHG-GR-AFC (CPC Scientific, Sunnyvale, CA, USA) was used for rabbit FIXa and FXa, and human activated protein C.
Wang, Xuelian, et al. Vaccine 31.49 (2013): 5806-5813.
“…four current good manufacturing practice-grade HPV16 E6 peptides [E6 1-45, E6 46-80, E6 81-115, and E6 116-158 (referred to as “peptides” hereafter); 10 μg/ml/peptide; made by CPC Scientific, Sunnyvale, CA…”
Zhen, Eugene Y., Richard E. Higgs, and Jesus A. Gutierrez. Analytical Biochemistry 442.1 (2013): 1-9.
"Both the stable isotope-labeled (SIL) and unlabeled apelin peptides [apelin-36, apelin-17, apelin-13, (pyr)apelin-13, and apelin-12] were synthesized by CPC Scientific (Sunnyvale, CA, USA)."
Sturm, Matthew B., et al. Science Translational Medicine 5.184 (2013): 184ra61-184ra61.
“For the clinical and pharmacology/toxicology studies, ASY*-FITC was GMP synthesized (CPC Scientific). Stability was evaluated by appearance (color), HPLC, and mass spectrometry for 3 years. The pharmacology/toxicology study in rats was conducted in accordance with FDA CFR title 21, part 58…”
Sun, Tzu-Lin, et al. Biophysical Journal 104.9 (2013): 1923-1932.
"NYAD-1 is H - Ile - Thr - Phe - X - Asp - Leu - Leu - X - Tyr - Tyr - Gly - Pro - NH2 (with special cyclization to get double bond, X = (S) - alpha - (2′-pentenyl)alanine) (4). NYAD-1 and CAI (H-Ile-Thr-Phe-Glu-Asp-Leu-Leu-Asp-Tyr-Tyr-Gly-Pro-NH2) were synthesized by CPC Scientific (San Jose, CA) under the supervision of Xiaohe Tong"
Mebrahtu, Efrem, et al. Nuclear Medicine and Biology 40.2 (2013): 190-196.
Here, we report the design and characterization of a dually radiolabeled peptide [ 64 Cu]c(RGDfE)K(DOTA)PLGVRY[ 123 I] for targeting cancer cells ... All peptides were purchased from CPC scientific (San Jose, CA.)
Bustad, Helene J., Lars Skjaerven, Ming Ying, Øyvind Halskau, Anne Baumann, David Rodriguez-Larrea, Miguel Costas, Jarl Underhaug, Jose M. Sanchez-Ruiz, and Aurora Martinez. PloS One 7, no. 11 (2012): e49671.
"The peptides TH-(1-43), i.e. MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIE, and its Ser19-phosphorylated counterpart THp-(1-43), i.e. MPTPDATTPQAKGFRRAVS(PO3)ELDAKQAEAIMSPRFIGRRQSLIE, were synthesized by CPC Scientific (San Jose, CA, USA) at approx. 90% purity, as seen by mass spectroscopy."
F.-H. Guo, et al. Journal of Nuclear and Radiochemistry, 34(3), 157-165 (2012)
Glucitol-Lys(NOTA)-DPhe-Cys-Tyr-DTrp-Lys-Thr-Cys-Thr-OH
Welsh, J. D., et al. Journal of Thrombosis and Haemostasis 10.11 (2012): 2344-2353.
"Thrombin-sensitive peptide (ThS-P) azidoacetyl alanine-K(5FAM)GALVPRGSAGK(CPQ2) was custom synthesized (2143 MW, > 95% purity; CPC scientific, Sunnyale, CA, USA) and dissolved in DMSO (20 mm ThS-P)."
Wang, W., Walker, N.D., Zhu, L.J., Wu, W., Ge, L., Gutstein, D.E., Yates, N.A., Hendrickson, R.C., Ogletree, M.L., Cleary, M. and Opiteck. Analytical Chemistry 84.15 (2012): 6891-6898.
- Departments of Molecular Biomarkers, Cardiovascular Diseases, and Clinical Pharmacology, Merck Research Laboratories, Rahway, New Jersey, United States.
"Peptide Stable isotope–labeled internal standard peptide (Q 7 and K 15 reciprocally cross-linked dimer of LTIGEGQQHHL*GGAKQAGDV, where L* represents 13 C 6 , 15 N 1 -labeled leucine) was synthesized and analyzed for purity and amino acid content (CPC Scientific)"
Gounder, Anshu P., et al. Journal of Biological Chemistry 287.29 (2012): 24554-24562.
"..folded HD5 was generated from a synthesized 80% pure linear peptide (CPC Scientific, Sunnyvale, CA) by thiol disulfide reshuffling overnight at room temperature in the presence of 3 mM reduced and 0.3 mM oxidized glutathione, 2 M guanidine hydrochloride, and 0.25 M sodium bicarbonate, pH 8.3, at a peptide concentration of 0.25 mg/ml [..] All α-defensins were quantified by UV absorbance at 280 nm using calculated molar extinction coefficients (18)."
Havukainen, Heli, et al. The Journal of Experimental Biology 215.11 (2012): 1837-1846.
"[..] polyserine tract of AmVg and NvVg were synthesized by CPC Scientific (Sunnyvale, CA, USA) for NMR analysis. The synthesis was performed after isotope-labeling expression attempts in Escherichia coli were deemed unsuitable [..] The peptides had the following sequences: AmVg (residues 358–392): EKLKQDILNLRTDISTS(Sp)SS(15I)SSSEENDFWQPKPT AmVg (residues 336–385): R(15V)SKT(15A)MNSNQI(15V)SDNS(15L)-(15S)STEEK(15L)KQDI(15L)N(15L)RTDI(15S)S(15S)(Sp)S(15A)IS (15S)(15S)EEND. NvVg (residues 351–385): EHKHSDESTSE(Sp)FES(15I)ADNNDDSYFQRKPKLTEAP." NvVg (residues 335–372): RPNK(15L)N(15L)QRRHDHKS(15G)EHKHSDE(15S)S-(15S)E(Sp)FE(15A)I(15A)DNNDD.
Dvir, Hay, et al. Proceedings of the National Academy of Sciences 109.18 (2012): 6916-6921.
"The biotinylated synthetic LDLR peptide [Biotin-PEG8-SINFDNPVYQKT (CPC Scientific)] was captured to ≈20–50 RU, whereas ≈200 RU of the J.D. mutant peptide (Biotin-PEG8-SINFDNPVCQKT) was required for proper detection of ARH binding."
Shojaei, Farbod, et al. Journal of Experimental & Clinical Cancer Research 31.1 (2012): 1.
- Pfizer Global Research and Development, Department of Oncology, La Jolla, CA, USA
"Epitope mapping studies were carried out using an overlapping series of synthetic peptides (CPC Scientific, CA) designed based on the primary sequence of OPN. Peptides corresponding to the region 143-172 of human OPN are listed below [..]"
Bhattacharya, Shibani, et al. Biopolymers 97.5 (2012): 253-264.
"The stapled peptides with greater than 90% purity were synthesized by.. CPC Scientific, CA"
Phillips, Chris, et al. Journal of the American Chemical Society 133.25 (2011): 9696-9699.
"Synthetic peptides that specifically bind nuclear hormone receptors offer an alternative approach to small molecules for the modulation of receptor signaling and subsequent gene expression. [..] Using a number of biophysical techniques, including crystal structure analysis of receptor–stapled peptide complexes, we describe in detail the molecular interactions and demonstrate that all-hydrocarbon staples modulate molecular recognition events."
Young, Travis S., et al. Proceedings of the National Academy of Sciences 108.27 (2011): 11052-11056.
"To determine the IC50 values of the selected cyclic peptides, we chemically synthesized the peptides C2 and G12 in both linear and cyclic forms (CPC Scientific)."
Mestecky, Jiri, et al. AIDS Research and Human Retroviruses 27.5 (2011): 469-486.
"The peptides were synthesized as 4-branch MAPS peptides that include a SGGRGG spacer at the C-terminal residue to distance the gp41 sequence from the MAPS (CPC Scientific; San Jose, CA)."
Gothard, Chris M., and James S. Nowick. The Journal of Organic Chemistry 75.6 (2009): 1822-1830.
This paper introduces the unnatural amino acids m-Abc2K and o-Abc2K as nanometer-sized building blocks for the creation of water-soluble macrocycles with well-defined shapes. m-Abc2K and o-Abc2K are homologues of the nanometer-sized amino acid Abc2K, which we recently introduced for the synthesis of water-soluble molecular rods of precise length. [J. Am. Chem. Soc. 2007, 129, 7272]. Abc2K is linear (180°), m-Abc2K creates a 120° angle, and o-Abc2K creates a 60° angle. m-Abc2K and o-Abc2K are derivatives of 3’-amino-[1,1’-biphenyl]-4-carboxylic acid and 2’-amino-[1,1’-biphenyl]-4-carboxylic acid, with two propyloxyammonium side chains for water solubility.
Leone, Marilisa, et al. Chemical Biology & Drug Design 77.1 (2011): 12-19.
"Cyclo-DEYDDPfK; Cyclo-DE(pY)LDPfK; Cyclo-DE(FCOOH)LDPfK (FCOOH= phenylalanine with a carboxyl group at the para position) were purchased either from the MCW facility of the Wisconsin Medical College or from CPC Scientific (San José, CA, USA)"
Pacholec, M., Bleasdale, J.E., Chrunyk, B., Cunningham, D., Flynn, D., Garofalo, R.S., Griffith, D., Griffor, M., Loulakis, P., Pabst, B. and Qiu, X.Journal of Biological Chemistry 285, no. 11 (2010): 8340-8351.
- Departments of Cardiovascular, Metabolic and Endocrine Diseases, and Structural Biology, Pfizer Global Research and Development, Groton, Connecticut 06340
The p53-derived peptides, TAMRA-p53 peptide and native p53 peptide, were custom-synthesized by CPC Scientific.
Llenado, R. Alan, et al. Infection and Immunity 77.11 (2009): 5035-5043.
"(R/K)-RMAD-4 [rhesus myeloid α-defensin 4] [(R1/2/5/7/10/13/14/26/33K)-RMAD-462-94] was custom synthesized by CPC Scientific, Inc. (San Jose, CA) and refolded as described previously…"
Crizer, David M., Yu Xia, and Scott A. McLuckey. Journal of the American Society for Mass Spectrometry 20.9 (2009): 1718-1722.
Phosphopeptide LPISASHpSpSKTR was synthesized by CPC Scientific (San Jose, CA, USA). Both peptides were diluted to a concentration of 20 μM in 49/49/2 (vol/vol/vol) methanol/water/ammonium hydroxide solution."
Wang, Xuelian, et al. Clinical and Vaccine Immunology 15.6 (2008): 937-945.
"A series of 15-mer peptides overlapping each other by 10 amino acids and a series of 9-mer peptides overlapping each other by 8 amino acids covering the HPV16 E6 protein have been described (20). To define the minimal and optimal amino acid sequences of the CD8 T-cell epitope, 8-mer, 10-mer, 11-mer, and homologous peptides (see Table 1) were synthesized as needed (CPC Scientific, Inc., San Jose, CA)."
Solowiej, J., Thomson, J.A., Ryan, K., Luo, C., He, M., Lou, J. and Murray, B.W. Biochemistry 47, no. 8 (2008): 2617-2630.
- Pfizer Global Research and DeVelopment, La Jolla, Pfizer Inc., 10777 Science Center Drive, San Diego, California 92121.
Peptide 4 [Dabcyl-KTSAVLQSGFRKME-Edans], peptide 5 [SITSAVLQ-pNA], and peptide 6 [SITSAVLQ-pNP] were purchased from CPC Scientific (San Jose, CA) and had the following purities: >95%, >93%, and >90.1%, respectively.
Gothard, Chris M., Nosheen A. Rao, and James S. Nowick. Journal of the American Chemical Society 129, no. 23 (2007): 7272-7273.
This paper introduces the unnatural amino acid Abc2K as a nanometer-length building block for the creation of water-soluble molecular rods of exceptional size. Abc2K is a water-soluble variant of the unnatural amino acid 4’-amino-[1,1’-biphenyl]-4-carboxylic acid (Abc) with lysinelike propyloxyammonium side chains at the 2- and 5-positions. The protected building block Fmoc-Abc2K(Boc)-OH (1) can be used in standard Fmoc-based solid-phase peptide synthesis to create water-soluble rodlike peptides in nanometer unit lengths up to at least ten nanometers.
Stair, Jacqueline L., et al. Journal of Combinatorial Chemistry 8.6 (2006): 929-934.
"The combinatorial library (CPC Scientific) was composed of the sequence GXXGXXGXXGXX (X = cysteine, aspartic acid, or glutamic acid; G = glycine) and synthesized onto TentaGel Macrobeads..."