“The PepCan peptide mixture will contain four HPV 16 E6 peptides: E6 1-45 (Ac-MHQKRTAMFQDPQER PRKLPQLCTELQTTIHDIILECVYCKQQLL-NH2..), E6 46-80 (Ac-RREVYDFAFRDLCIV YRDGN PYA VCDKCLKFYSKI-NH2..), E6 81-115 (Ac-SEYRHYCYSLYGTTLEQQYNK PLCDLLIRCINCQK-NH2..), and E6 116-158 (Ac-PLCPEEKQRHLDKKQRFHNIRGRWT GRCMSCCRSSRTRRETQL-NH2..) (U.S. Pat. No. 8,652,482). Commercially produced cGMP-grade peptides (CPC Scientific, San Jose, Calif.) will be examined..”
US Patent GMP Peptide Citation

Abstract

Provided herein is a method of stimulating a systemic T helper cell type 1 response in a person in need thereof, the method comprising: injecting a composition comprising a recall antigen intradermally in a person in need thereof; wherein the method is not a method of treating a herpes simplex virus infection; and wherein the method does not comprise injecting a composition comprising a recall antigen intradermally into a viral epithelial lesion; and (i) wherein the person is infected with a microorganism and afflicted with a disease caused by the microorganism, and the composition comprising a recall antigen does not comprise an antigen of the microorganism infecting the person; or (ii) wherein the person is afflicted with a cancer, and the composition comprising a recall antigen does not comprise an antigen of the cancer afflicting the person.

SOCIAL MEDIA

Connect with us and stay updated by following our social media channels.

Latest Briefings from our Knowledge Center

Press Releases, Industry News, Articles, and Technical Content

  • Nextgen Biomed 2025 Joseph Denby

    At NextGen Biomed 2025, Joseph Denby delivered a cutting-edge presentation highlighting the critical role green chemistry plays in the sustainable production of peptide APIs and peptide–oligo conjugates...

    March 17th, 2025Articles
  • CPC Scientific DCAT Dinner 2025 with Theresa Cheng, Tim Nieters, and Diego Silva

    Home / Knowledge Center / Articles

    CPC Scientific at DCAT 2025!

    GMP Peptide Manufacturing

    What an amazing time we had at DCAT 2025! It was fantastic to meet with colleagues, clients, and friends, and showcase CPC Scientific’s cutting-edge capabilities in synthetic API development and commercial production.

    A heartfelt […]

    March 14th, 2025Articles
  • ISO 22716:2007(E) Cosmetic Guidelines

    We are excited to share that CPC Scientific Inc. has officially received the Good Manufacturing Practice (GMP) Certificate in accordance with the ISO 22716:2007(E) Cosmetic Guidelines.

    This certification highlights our unwavering commitment to delivering the highest quality peptide ingredients for cosmetic use, guaranteeing:

    • Superior Quality Control – Striving for excellence in safety, consistency, and purity.
    • […]

    February 5th, 2025Press Releases
  • Green Synthesis of Goserelin Impurity E

    In Part 1 of our Minimal Protection Group Strategies for SPPS, we discussed methods for eliminating sidechain protection on hydroxy-bearing amino acids such as serine, threonine, tyrosine, and hydroxyproline. By omitting t-butyl protection, we enhanced atom economy and avoided the use of hazardous solvents typically required to remove these protection groups. In Part 2, we present a new case study, expanding our approach to include the unprotected side chains of histidine, tryptophan, and arginine. We demonstrate the synthesis of a Goserelin peptide API impurity, showcasing how a convergent peptide fragment strategy can be used to eliminate the need for TFA and diethyl ether, eliminate side chain protection of Arginine, Histidine, and Tryptophan.

    January 31st, 2025publications, White Papers
  • RP-182 Synthesis by click chemistry

    The synthesis of the linear RP-182 analog, bicyclo[6.1.0]non-4-yn-9-ylmethyloxycarbonyl-PEG2-Lys-Phe-Arg-Lys-Ala-Phe-Lys-Arg-Phe-Phe-Lys(azido-PEG)-NH2, was achieved using standard solid-phase peptide synthesis (SPPS) protocols. After cleaving the linear peptide from the resin, macrocyclization was performed in the liquid phase through a strain-promoted click reaction. BCN introduces extra ring strain due to its fused cyclopropane structure. The combined effect of ring strain, the selection of BCN, and copper catalysis significantly increases the macrocyclization efficiency of longer peptides like RP-182.

  • Nakagawa, Mayumi, Teresa Evans, Milan Bimali, Hannah Coleman, Jasmine Crane, Nadia Darwish, Jennifer L. Faulkner et al. MedRxiv (2025): 2025-01.

    The vaccine consisted of four current good manufacturing production-grade synthetic peptides covering the HPV 16 E6 protein [amino acid (aa)1-45, 46-80, 81-115, and 116-158] (CPC Scientific, San Jose, CA [..]

  • triple-stapled peptide case study Zhan cat

    Stapled peptides have emerged as a powerful tool in drug discovery and therapeutic development due to their ability to overcome the limitations associated with traditional peptide drugs, such as poor stability and low cell permeability. By introducing staples into the peptide backbone, researchers can stabilize peptide conformations and enhance their interactions with target proteins, resulting in improved efficacy and specificity. This approach not only addresses the challenges of peptide drug design but also opens new avenues for targeting challenging biomolecular interactions that are difficult to modulate with small molecules or antibodies. The development of stapled peptides has led to significant advancements in targeting protein-protein interactions, addressing previously intractable diseases, and enhancing the precision of therapeutic interventions.

  • Peptide Receptor Radionuclide Therapeutic DOTAGA-(I-y)fk(Sub-KuE)

    Peptide receptor radionuclide therapy (PRRT) is a targeted therapeutic approach that utilizes peptides to deliver cytotoxic radiation to specific receptors overexpressed on cancer cells. Peptides offer several advantages as therapeutic vectors in PRRT due to their small size, favorable pharmacokinetics, high binding affinity, low immunogenicity and toxicity, and minimal off-target effects. Tumor-targeting peptides conjugated to radionuclide chelates represent a promising class of cancer therapeutics.

    October 14th, 2024publications, White Papers
  • RP-182 copper-free click chemistry bifunctional linker

    Singh, S.S., Calvo, R., Kumari, A., Sable, R.V., Fang, Y., Tao, D., Hu, X., Castle, S.G., Nahar, S., Li, D. and Major, E. Molecular Cancer Therapeutics (2024).

    • CPC Scientific Inc., 160E Tasman Dr., Suite 200, San Jose, CA 95134

    [..] assembling the peptide on the Rink Amide resin and attaching the PEG azide moiety to the N-terminal Lys, the Dde group was removed as previously shown and coupled to the Fmoc-PEG2-acid. Removal of the Fmoc followed by simultaneously click/coupling to bicyclo[6.1.0]non-4-yn-9-ylmethyl (2,5-dioxopyrrolidin-1-yl) carbonate gave 1c which was deprotected and cleaved from the resin to give 1c.

Contact Us