"The tandem peptide library used in this work was synthesized via standard FMOC solid-phase peptide synthesis and purified by high-performance liquid chromatography at the MIT Biopolymers Core, Tufts University Core Facility or CPC Scientific, Inc."
Abstract
Aspects of the invention provide compositions and methods for delivering nucleic acids to target cells.
Latest Briefings from our Knowledge Center
Press Releases, Industry News, Articles, and Technical Content
Saenz, Rebecca, et al. J Translational Medicine 12 (2014): 211.
“…Hp91 (DPNAPKRPPSAFFLFCSE), Hp121 (SIGDVAKKLGEMWNNTAA), scrambled Hp91 (ASLAPPFPNCFDPKSREF), and OVA-I (SIINFEKL) were all synthesized at GMP facilities by [..] CPC Scientific (San Jose, CA, USA). Peptides were synthesized with an N-terminal biotin, acetyl, or fluorescent tag (Cp488) as indicated in the figure legends. Peptides were routinely synthesized with greater than 95% purity.”
August 14th, 2014Citations, GMP Peptide ManufacturingWilson, Sarah S., et al. Mucosal Immunology 8.2 (2015): 352-361.
"Folded Crp23 was created from a synthesized 80% pure linear peptide (CPC Scientific, Sunnyvale, CA) by the same procedure as previously reported for the α-defensin HD5"
August 13th, 2014Antimicrobial Peptides, Citations, Multiple Disulfide BridgesNg, Quinn KT, et al. Biomaterials 35.25 (2014): 7050-7057.
"Linear and cyclic targeting sequences of the peptides CCVVVT-EG4-GRGDSP-NH2 (97%) (Cap-lRGD) and c[RGDfK(CCVVVT-EG 4 )] (96%) (Cap-cRGD) were purchased from CPC Scientific."
August 1st, 2014Citations, Peptide MacrocyclesHarper, Brett, Mahsan Miladi, and Touradj Solouki. Journal of The American Society for Mass Spectrometry 25.10 (2014): 1716-1729.
"antipeptide (EGVYVHPV), angiotensin II, human (DRVYIHPF), and isotopically (13C) labeled heptapeptide (AAAAHAA-NH2 [where “A” indicates a carbon thirteen (13C) isotope on the alanine carbonyl group]) were purchased from CPC Scientific Incorporated (Sunnyvale, CA)"
July 29th, 2014Citations, Isotope-Labeled PeptidesChoi, Ka-Yee G., Scott Napper, and Neeloffer Mookherjee. Immunology 143.1 (2014): 68-80.
"Peptides LL-37 ([LL-37, 37 aa]), a scrambled LL-37, sLL-37 (RSLEGTDRFPFVRLKNSRKLEFKDIKGIKREQFVKIL) and IG-19 (IGKEFKRIVQRIKDFLRNL-NH2) were obtained from CPC Scientific (Sunnyvale, CA). The peptides were re-suspended in endotoxin-free water and stored at −20° until needed."
March 25th, 2014Antimicrobial Peptides, CitationsHuang, Q., Johnson, T.W., Bailey, S., Brooun, A., Bunker, K.D., Burke, B.J., Collins, M.R., Cook, A.S., Cui, J.J., Dack, K.N. and Deal, J.G. Journal of Medicinal Chemistry 57, no. 4 (2014): 1170-1187.
- La Jolla Laboratories, Pfizer Worldwide Research and Development, 10770 Science Center Drive, San Diego, California 92121
The reactions were conducted in 50-μL volumes in 96-well plates and contained 1.3 nM wild-type or 0.5 nM mutant ALK, 3 μM phosphoacceptor peptide (5′FAM-KKSRGDYMTMQIG-CONH2, synthesized by CPC Scientific, Sunnyvale, CA)..
January 16th, 2014Citations, Dye-LabeledSkjevik, Åge Aleksander, et al. Journal of Molecular Biology 426.1 (2014): 150-168.
"The peptides TH-(1-43) (MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIE) and THp-(1-43) (MPTPDATTPQAKGFRRAVS(PO3)2-ELDAKQAEAIMSPRFIGRRQSLIE) were synthesized by CPC Scientific (San Jose, CA) at approximately 90% purity, as seen by mass spectroscopy, and used without further purification."
January 9th, 2014Citations, Long Sequences, Phosphorylated PeptidesYu, Yang, et al. Science China Life Sciences 57.1 (2014): 117-127.
"The peptides, shown in Figure 1, were designed and synthesized. MPER (RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR), TT peptide (FNNFTVSFWLRVPKVSASHLE), T10HE peptide (FNNFTVSFWLRVPKVSASHLE-PEG2-LWNWF-S5-ITN-S5-LWYIR-PEG2-KK), and T10E peptide (FNNFTVSFWLRVPKVSASHLEPEG2-LWNWFDITNWLWYIR-PEG2-KK) were purchased from CPC Scientific Inc. (Sunnyvale, CA, USA)."
December 26th, 2013Citations, PEGylationZekavat, Behrooz, et al. J. Am. for Mass Spectrometry 25.2 (2014): 226-236.
"The synthesized cyclo-(RPKPQQFFGL) peptide and human angiotensin II were purchased from CPC Scientific (CPC Scientific Inc., Sunnyvale, CA, USA)."
December 18th, 2013Citations, Peptide Macrocycles