"Epitope mapping studies were carried out using an overlapping series of synthetic peptides (CPC Scientific, CA) designed based on the primary sequence of OPN. Peptides corresponding to the region 143-172 of human OPN are listed below [..]"

Abstract

Osteopontin (OPN), also known as SPP1 (secreted phosphoprotein), is an integrin binding glyco-phosphoprotein produced by a variety of tissues. In cancer patients expression of OPN has been associated with poor prognosis in several tumor types including breast, lung, and colorectal cancers. Despite wide expression in tumor cells and stroma, there is limited evidence supporting role of OPN in tumor progression and metastasis. Using phage display technology we identified a high affinity a nti-O PN m onoclonal antibody (hereafter AOM1). The binding site for AOM1 was identified as SVVYGLRSKS sequence which is immediately adjacent to the RGD motif and also spans the thrombin cleavage site of the human OPN. AOM1 efficiently inhibited OPNa binding to recombinant integrin αvβ3 with an IC50 of 65 nM. Due to its unique binding site, AOM1 is capable of inhibiting OPN cleavage by thrombin which has been shown to produce an OPN fragment that is biologically more active than the full length OPN. Screening of human cell lines identified tumor cells with increased expression of OPN receptors (αvβ3 and CD44v6) such as mesothelioma, hepatocellular carcinoma, breast, and non-small cell lung adenocarcinoma (NSCLC). CD44v6 and αvβ3 were also found to be highly enriched in the monocyte, but not lymphocyte, subset of human peripheral blood mononuclear cells (hPBMCs). In vitro, OPNa induced migration of both tumor and hPBMCs in a transwell migration assay. AOM1 significantly blocked cell migration further validating its specificity for the ligand. OPN was found to be enriched in mouse plasma in a number of pre-clinical tumor model of non-small cell lung cancers. To assess the role of OPN in tumor growth and metastasis and to evaluate a potential therapeutic indication for AOM1, we employed a KrasG12D-LSLp53fl/fl subcutaneously implanted in vivo model of NSCLC which possesses a high capacity to metastasize into the lung. Our data indicated that treatment of tumor bearing mice with AOM1 as a single agent or in combination with Carboplatin significantly inhibited growth of large metastatic tumors in the lung further supporting a role for OPN in tumor metastasis and progression.

“Epitope mapping studies were carried out using an overlapping series of synthetic peptides (CPC Scientific, CA) designed based on the primary sequence of OPN. Peptides corresponding to the region 143-172 of human OPN are listed below:

1. 143EVFTPVVPTVDTYDGRGDSVVYGLRSKSKK172
2. 143EVFTPVVPTVDTYDGRGDSVVYGLR167
3. 143EVFTPVVPTVDTYD156
4. 156DGRGDSVVYGLRSKSKK172″

SOCIAL MEDIA

Connect with us and stay updated by following our social media channels.

Latest Briefings from our Knowledge Center

Press Releases, Industry News, Articles, and Technical Content

  • Kategaya, L., Di Lello, P., Rougé, L., Pastor, R., Clark, K.R., Drummond, J., Kleinheinz, T., Lin, E., Upton, J.P., Prakash, S. and Heideker, J. Nature 550.7677 (2017): 534.

    1. Departments of Discovery Oncology, Early Discovery Biochemistry, Structural Biology, Discovery Chemistry, Biochemical and Cellular Pharmacology, Protein Chemistry, Microchemistry, Proteomics, and Lipidomics, Research Pathology, Bioinformatics and Computational Biology, and Translational Oncology, Genentech, South San Francisco, 94080, California, USA
    2. Department of Pharmaceutical Chemistry and Small Molecule Discovery Center, University of California, San Francisco, San Francisco, 94143, California, USA
    3. MRC Protein Phosphorylation and Ubiquitylation Unit, School of Life Sciences, University of Dundee, Dundee, DD1 5EH, UK
    4. Institute for Cell and Molecular Biosciences, Newcastle University, Newcastle upon Tyne, NE2 1HH, UK

    "The 5-TAMRA (5-carboxytetramethylrhodamine) peptide was generated by CPCScientific consisting of the sequence 5-TAMRA-YPYDVPDYAIREIVSRNKRRYQEDG.."

    October 26th, 2017Citations, Dye-Labeled
  • Boehm, M., Beaumont, K., Jones, R.M., Kalgutkar, A.S., Zhang, L., Atkinson, K., Bai, G., Brown, J.A., Eng, H., Goetz, G.H. and Holder, B.R. Journal of Medicinal Chemistry (2017).

    1. Pfizer Worldwide Research & Development, Cambridge, Massachusetts 02139, United States
    2. Pfizer Worldwide Research & Development, Groton, Connecticut 06340, United States

    The chemokine receptor CXCR7 is an attractive target for a variety of diseases. While several small-molecule modulators of CXCR7 have been reported, peptidic macrocycles may provide advantages in terms of potency, selectivity, and reduced off-target activity

    October 18th, 2017Citations, Peptoids
  • Bainbridge, Travis W., et al. Scientific Reports 7.1 (2017): 12524.

    • Protein Chemistry, Molecular Oncology, Discovery Chemistry, Cancer Immunology, and Neuroscience. Genentech Inc., South San Francisco, CA, 94080, USA

    "ANP FAP and aP NIRF were synthesized by CPC Scientific (Sunnyvale, CA)… Another internally-quenched FRET peptide substrate (ANPFAP) for FAP has recently been reported and demonstrated for use as an activity-based, in vivo imaging tool. The peptide sequence contains two internal Gly-Pro dipeptide motifs, susceptible to FAP cleavage and a Cy5.5/QSY21, quenched-FRET pair."

  • Coorens, Maarten, et al. The Journal of Immunology 199.4 (2017): 1418-1428.

    "CATH-2 and LL-37 were synthesized by Fmoc-chemistry at CPC Scientific (Sunnyvale, CA)."

  • Tcholakov, I., Grimshaw, C.E., Shi, L., Kiryanov, A., Murphy, S.T., Larson, C.J., Plonowski, A. and Ermolieff, J. Bioscience Reports 37, no. 3 (2017): BSR20170275.

    • Departments of In Vitro Pharmacology, Immunology, Enzymology and Biophysical Chemistry, Medicinal Chemistry, External Innovation, Metabolic Disease, In Vitro Pharmacology, and Gastrointestinal and Enterology Discovery Unit, Takeda California, Inc., 10410 Science Center Drive, San Diego, CA 92121, U.S.A

    The substrate used for our PHD2 kinetic study was a 17-mer peptide mimicking the sequence of HIF-1a surrounding the Pro564 residue hydroxylated by the PHD enzymes (Biotin-DLEMLAPYIPMDDDFQL). The substrate used for FIH1 was a 34-mer peptide mimicking the sequence of HIF-1α surrounding residue Asn803 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL). Both peptides were synthesized by CPC Scientific Inc.

    June 30th, 2017Citations
  • Wilson, Sarah S., et al. PLoS Pathogens 13.6 (2017): e1006446.

    "Cryptdin 2 (UniProtKB: P28309, LRDLVCYCRTRGCKRRERMNGTCRKGHLMYTLCCR)... obtained by oxidative refolding of partially purified linear peptides (synthesized by CPC Scientific...) and purifying the correctly folded species by reverse-phase high-pressure liquid chromatography (RP-HPLC). Purity was determined by analytical RP-HPLC, and the mass of the disulfide-bonded peptides was verified by high mass accuracy liquid chromatography-mass spectrometry."

  • Metal chelating peptide Pep-1L-NOTA

    Sattiraju, A., et al. Oncotarget 2017, 8 (26), 42997-43007.

    For Ac-225 labeling, the prepared DOTA-Pep-1L (CPC-scientific, San Jose, CA) was incubated with Ac-225 at 70°C for 50 minutes. The TLC plates were scanned on a BioScan Imaging Scanner. Cu-64 was purchased from Washington University in St. Louis. The custom peptide specific to IL13RA2 and a scrambled peptide were conjugated with NOTA by CPC scientific Inc (San Jose, CA). Both the peptides, Pep-1L and scrambled peptide-NOTA were radiolabeled with Cu-64 according to the previously reported methods [15].

  • Puthenveetil, Sujiet, et al. PloS One 12.5 (2017): e0178452.

    1. Worldwide Medicinal Chemistry, Pfizer Global R&D, Groton, Connecticut, United States of America.
    2. Pfizer Oncology Research, Pearl River, NY, United States of America.

    "Peptide-payload conjugate (7) was prepared by reacting 2mM aizoacetyl-Ser-Lys-Gly-Ser-Lys (CPC scientific, inc. Sunnywale, CA) with 8 mM NHS-ester payload [19] in 50% Dimethyl sulfoxide (DMSO), 50 mM borate buffer pH 8.5 for 2 h at 37°C."

    May 30th, 2017Citations, Click Peptides
  • Kwon, Ester J., et al. Advanced Materials 29.35 (2017).

    "[..] synthesized for initial screening with FAM-conjugated lysine at the C-terminal end of the membrane-interactive peptide and with or without D[KLAKLAK]2 on the C-terminus using standard Fmoc chemistry[..] All peptides were synthesized with N-terminal myristic acid and C-terminal amine. [..] larger quantities of the peptides were synthesized by CPC Scientific to 90% purity"

Contact Us