"The tandem peptide library used in this work was synthesized via standard FMOC solid-phase peptide synthesis and purified by high-performance liquid chromatography at the MIT Biopolymers Core, Tufts University Core Facility or CPC Scientific, Inc."
Latest Briefings from our Knowledge Center
Press Releases, Industry News, Articles, and Technical Content
Melgar-Asensio, Ignacio, et al. Investigative Ophthalmology & Visual Science 59.10 (2018): 4071-4081.
Thio-peptide: NH2-Cys-PEG4-Sar-YNLYRVRS-NH2, MW 1,490 g/mol was custom synthesized, via solid state methods by CPC Scientific (Sunnyvale, CA, USA).
Hornigold, D.C., Roth, E., Howard, V., Will, S., Oldham, S., Coghlan, M.P., Blouet, C. and Trevaskis, J.L. Appetite 127 (2018): 334-340.
- Cardiovascular and Metabolic Diseases, MedImmune Ltd, Milstein Building, Granta Park, Cambridge, CB21 6GH, UK
- University of Cambridge, Department of Clinical Biochemistry, MRC Metabolic Diseases Unit, Addenbrooke's Hospital, Cambridge, CB2 0QQ, UK
- Cardiovascular and Metabolic Diseases, MedImmune LLC, One MedImmune Way, Gaithersburg, MD 20878, USA
AC3174 (Amylin Pharmaceuticals) is a functional analog of exenatide (Hargrove et al., 2007). AC170222 (Hpa-Nle-Gly-Trp-Lys(Tac)-Asp-NMePhe-NH2; CPC Scientific, Sunnyvale, CA) is a CCKR1-selective peptide (Pierson et al., 2000).
Hewings, D.S., Heideker, J., Ma, T.P., AhYoung, A.P., El Oualid, F., Amore, A., Costakes, G.T., Kirchhofer, D., Brasher, B., Pillow, T. and Popovych, N. Nature Communications 9, no. 1 (2018): 1162.
- Discovery Oncology, Genentech, South San Francisco, California, 94080, USA
- Early Discovery Biochemistry, Genentech, South San Francisco, California, 94080, USA
The 5-TAMRA (5-Carboxytetramethylrhodamine) peptide was generated by CPC-Scientific consisting of the sequence 5-TAMRA-YPYDVPDYAIREIVSRNKRRYQEDG. K63 or K48 tetra-Ub chains were conjugated to the peptide via its lysine residue [..]
Nuss, Andrew B., and Mark R. Brown. General and Comparative Endocrinology (2017).
"A bioactive form of AaILP3 (norLeu substituted for Met) was synthesized in the laboratory (Brown et al., 2008) and later by CPC Scientific, Inc. (Sunnyvale, CA). [..] stephensi ILP3 and ILP4 (CPC Scientific, Inc.)"
Nakagawa, Mayumi. U.S. Patent Application 15/552,285, filed February 15, 2018.
“The PepCan peptide mixture will contain four HPV 16 E6 peptides: E6 1-45 (Ac-MHQKRTAMFQDPQER PRKLPQLCTELQTTIHDIILECVYCKQQLL-NH2..), E6 46-80 (Ac-RREVYDFAFRDLCIV YRDGN PYA VCDKCLKFYSKI-NH2..), E6 81-115 (Ac-SEYRHYCYSLYGTTLEQQYNK PLCDLLIRCINCQK-NH2..), and E6 116-158 (Ac-PLCPEEKQRHLDKKQRFHNIRGRWT GRCMSCCRSSRTRRETQL-NH2..) (U.S. Pat. No. 8,652,482). Commercially produced cGMP-grade peptides (CPC Scientific, San Jose, Calif.) will be examined..”
Dekker, Petrus Jacobus Theodorus, René Marcel De Jong, and Cornelis Marinus Muijlwijk. U.S. Patent Application No. 14/397,866.
"The internal standard (ISTD) WIL*GDVFIREYYSV*FDR was ordered from CPC Scientific (Sunnyvale, Calif., USA) and contained L*6×13C 1×15N and V*5×13C 1×15N. The ISTD contained an internal trypsin cleavage site in order to monitor the digestion with trypsin to completion."
Wuerth, Kelli C., Reza Falsafi, and Robert EW Hancock. PloS One 12, no. 11 (2017): e0187565.
"LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2) was purchased from CPC Scientific (Sunnyvale, California, USA).."
Kategaya, L., Di Lello, P., Rougé, L., Pastor, R., Clark, K.R., Drummond, J., Kleinheinz, T., Lin, E., Upton, J.P., Prakash, S. and Heideker, J. Nature 550.7677 (2017): 534.
- Departments of Discovery Oncology, Early Discovery Biochemistry, Structural Biology, Discovery Chemistry, Biochemical and Cellular Pharmacology, Protein Chemistry, Microchemistry, Proteomics, and Lipidomics, Research Pathology, Bioinformatics and Computational Biology, and Translational Oncology, Genentech, South San Francisco, 94080, California, USA
- Department of Pharmaceutical Chemistry and Small Molecule Discovery Center, University of California, San Francisco, San Francisco, 94143, California, USA
- MRC Protein Phosphorylation and Ubiquitylation Unit, School of Life Sciences, University of Dundee, Dundee, DD1 5EH, UK
- Institute for Cell and Molecular Biosciences, Newcastle University, Newcastle upon Tyne, NE2 1HH, UK
"The 5-TAMRA (5-carboxytetramethylrhodamine) peptide was generated by CPCScientific consisting of the sequence 5-TAMRA-YPYDVPDYAIREIVSRNKRRYQEDG.."
Boehm, M., Beaumont, K., Jones, R.M., Kalgutkar, A.S., Zhang, L., Atkinson, K., Bai, G., Brown, J.A., Eng, H., Goetz, G.H. and Holder, B.R. Journal of Medicinal Chemistry (2017).
- Pfizer Worldwide Research & Development, Cambridge, Massachusetts 02139, United States
- Pfizer Worldwide Research & Development, Groton, Connecticut 06340, United States
The chemokine receptor CXCR7 is an attractive target for a variety of diseases. While several small-molecule modulators of CXCR7 have been reported, peptidic macrocycles may provide advantages in terms of potency, selectivity, and reduced off-target activity