"The tandem peptide library used in this work was synthesized via standard FMOC solid-phase peptide synthesis and purified by high-performance liquid chromatography at the MIT Biopolymers Core, Tufts University Core Facility or CPC Scientific, Inc."
Latest Briefings from our Knowledge Center
Press Releases, Industry News, Articles, and Technical Content
Bustad, Helene J., Lars Skjaerven, Ming Ying, Øyvind Halskau, Anne Baumann, David Rodriguez-Larrea, Miguel Costas, Jarl Underhaug, Jose M. Sanchez-Ruiz, and Aurora Martinez. PloS One 7, no. 11 (2012): e49671.
"The peptides TH-(1-43), i.e. MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIE, and its Ser19-phosphorylated counterpart THp-(1-43), i.e. MPTPDATTPQAKGFRRAVS(PO3)ELDAKQAEAIMSPRFIGRRQSLIE, were synthesized by CPC Scientific (San Jose, CA, USA) at approx. 90% purity, as seen by mass spectroscopy."
F.-H. Guo, et al. Journal of Nuclear and Radiochemistry, 34(3), 157-165 (2012)
Glucitol-Lys(NOTA)-DPhe-Cys-Tyr-DTrp-Lys-Thr-Cys-Thr-OH
Welsh, J. D., et al. Journal of Thrombosis and Haemostasis 10.11 (2012): 2344-2353.
"Thrombin-sensitive peptide (ThS-P) azidoacetyl alanine-K(5FAM)GALVPRGSAGK(CPQ2) was custom synthesized (2143 MW, > 95% purity; CPC scientific, Sunnyale, CA, USA) and dissolved in DMSO (20 mm ThS-P)."
Wang, W., Walker, N.D., Zhu, L.J., Wu, W., Ge, L., Gutstein, D.E., Yates, N.A., Hendrickson, R.C., Ogletree, M.L., Cleary, M. and Opiteck. Analytical Chemistry 84.15 (2012): 6891-6898.
- Departments of Molecular Biomarkers, Cardiovascular Diseases, and Clinical Pharmacology, Merck Research Laboratories, Rahway, New Jersey, United States.
"Peptide Stable isotope–labeled internal standard peptide (Q 7 and K 15 reciprocally cross-linked dimer of LTIGEGQQHHL*GGAKQAGDV, where L* represents 13 C 6 , 15 N 1 -labeled leucine) was synthesized and analyzed for purity and amino acid content (CPC Scientific)"
Gounder, Anshu P., et al. Journal of Biological Chemistry 287.29 (2012): 24554-24562.
"..folded HD5 was generated from a synthesized 80% pure linear peptide (CPC Scientific, Sunnyvale, CA) by thiol disulfide reshuffling overnight at room temperature in the presence of 3 mM reduced and 0.3 mM oxidized glutathione, 2 M guanidine hydrochloride, and 0.25 M sodium bicarbonate, pH 8.3, at a peptide concentration of 0.25 mg/ml [..] All α-defensins were quantified by UV absorbance at 280 nm using calculated molar extinction coefficients (18)."
Havukainen, Heli, et al. The Journal of Experimental Biology 215.11 (2012): 1837-1846.
"[..] polyserine tract of AmVg and NvVg were synthesized by CPC Scientific (Sunnyvale, CA, USA) for NMR analysis. The synthesis was performed after isotope-labeling expression attempts in Escherichia coli were deemed unsuitable [..] The peptides had the following sequences: AmVg (residues 358–392): EKLKQDILNLRTDISTS(Sp)SS(15I)SSSEENDFWQPKPT AmVg (residues 336–385): R(15V)SKT(15A)MNSNQI(15V)SDNS(15L)-(15S)STEEK(15L)KQDI(15L)N(15L)RTDI(15S)S(15S)(Sp)S(15A)IS (15S)(15S)EEND. NvVg (residues 351–385): EHKHSDESTSE(Sp)FES(15I)ADNNDDSYFQRKPKLTEAP." NvVg (residues 335–372): RPNK(15L)N(15L)QRRHDHKS(15G)EHKHSDE(15S)S-(15S)E(Sp)FE(15A)I(15A)DNNDD.
Dvir, Hay, et al. Proceedings of the National Academy of Sciences 109.18 (2012): 6916-6921.
"The biotinylated synthetic LDLR peptide [Biotin-PEG8-SINFDNPVYQKT (CPC Scientific)] was captured to ≈20–50 RU, whereas ≈200 RU of the J.D. mutant peptide (Biotin-PEG8-SINFDNPVCQKT) was required for proper detection of ARH binding."
Shojaei, Farbod, et al. Journal of Experimental & Clinical Cancer Research 31.1 (2012): 1.
- Pfizer Global Research and Development, Department of Oncology, La Jolla, CA, USA
"Epitope mapping studies were carried out using an overlapping series of synthetic peptides (CPC Scientific, CA) designed based on the primary sequence of OPN. Peptides corresponding to the region 143-172 of human OPN are listed below [..]"
Patel, M. A., F. Riley, M. Ashraf-Khorassani, and L. T. Taylor. Journal of Chromatography A 1233 (2012): 85-90.
- Global Research & Development, Pfizer, Inc., Groton, CT 06340, USA
Uncapped peptides containing both an amine and carboxyl terminus were synthesized by CPC Scientific Inc. (San Jose, CA) for this research. The linear isomeric peptides exhibited high water solubility (e.g. 1 mg/mL).